KEGG   Enterobacter cloacae EcWSU1: EcWSU1_03052Help
Entry
EcWSU1_03052      CDS       T01652                                 

Gene name
casB
Definition
(GenBank) Phospho-cellobiase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00010  Glycolysis / Gluconeogenesis
eec00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_03052 (casB)
   00500 Starch and sucrose metabolism
    EcWSU1_03052 (casB)
Enzymes [BR:eec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EcWSU1_03052 (casB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AEW74480
UniProt: G8LJT2
LinkDB All DBs
Position
complement(3170031..3171425)
Genome map
AA seq 464 aa AA seqDB search
MKTFPDDFLWGGAVAANQVEGAYREDGKGLSTSDVQPQGVFGPVVERVEGDSGIKDIAID
FYHRYPEDIKLFAEMGFSCLRVSIAWTRIFPNGDEQHPNEAGLAFYDKLFDELAAHNITP
LVTLSHYEMPWGLVKQYGGWASRQTIGFFERYARTVFTRYKTKVKLWLTFNEINMSLHAP
MTGVGLPETSSKGEVYQAIHHQLVASALAVKACHEIIADARIGNMLLGGLMYPLTCKPED
ILETLQENRAWQFFGDVQCRGVYPGYMQRFFRDNDIQIDITDADREALKSTVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPVGLRTLLNVLWDRYQKPLFIV
ENGLGAKDTPDADGVVQDDYRISYLNDHLVQVREAIEDGVEVMGYTSWGPIDLVSASKAE
LSKRYGFIYVDRDDSGKGTLTRSRKKSFYWYKEVIATKGASLKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttcccggatgattttttatggggcggtgcggttgccgcgaatcaggtagaa
ggcgcttatcgggaagacggtaaagggttgtccacctctgacgtccagccgcagggagtt
tttggcccggtggttgagcgcgtcgagggcgacagcggcatcaaggatatcgcgattgat
ttctatcatcgataccccgaggacatcaaactgttcgccgagatgggctttagctgcctg
cgcgtttccattgcctggacacgcattttcccgaacggcgacgagcagcaccctaacgaa
gcggggctggctttttacgacaaactgtttgacgaactggccgcgcacaacatcacgccg
cttgtcacactgtcgcattacgaaatgccgtgggggttggtgaagcagtacggaggctgg
gccagccgtcagaccattgggttctttgagcgctatgcccgtaccgtatttacgcgctac
aaaacgaaggtaaagctgtggctgacgtttaatgagatcaacatgtctctgcatgcaccg
atgaccggcgtcggcctgccggaaaccagcagcaaaggtgaggtgtatcaggctatccat
catcaactggtggctagcgcgctggcagtgaaagcctgccatgagatcattgcagacgcc
cggattggcaacatgttgctgggcggtctgatgtatccgctgacctgcaagccggaagat
atcctggaaacactgcaggaaaaccgcgcctggcaattctttggcgacgtgcagtgccgt
ggtgtttatccggggtatatgcagcgcttcttccgcgataacgatatccagattgatatc
accgatgccgatcgcgaggcgctgaaatcgaccgtcgattttatctcgttcagttactac
atgacgggatgtgttaccgcggatgaggcgcttaatcagcaggctcggggcaatatcctt
agcatggtacctaacccgcatctggctagttccgagtggggctggcagattgaccctgtc
ggcctgcgtaccctgctgaacgtgctctgggatcgctatcagaagccgctgtttatcgtg
gaaaacggtctgggcgcgaaagacacgccggatgctgacggcgtagtgcaggatgattac
cgcatcagctaccttaacgaccacctggtacaggtgcgtgaagccattgaagatggtgtg
gaggtaatgggttacaccagttgggggccgatcgatctggtcagtgcgtctaaagcagaa
ctctcaaaacgctatggctttatttatgtcgatcgtgatgacagtggaaaagggacgtta
acgcgcagtcgtaagaaaagcttctactggtataaagaggttattgccacaaaaggcgct
tccctgaaagcataa

DBGET integrated database retrieval system