KEGG   Electrophorus electricus (electric eel): 113569522
Entry
113569522         CDS       T05787                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
eee  Electrophorus electricus (electric eel)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 113569522
NCBI-ProteinID: XP_026853304
LinkDB
Position
Unknown
AA seq 367 aa
MSFGEFIELKELAVEDRIELTAPIPHRTPRLERVNALRISPGKFPDLFNRVRIIRLLGDS
MKDPRLVEETGEGHNFQPCSHAQPTWCDLCGDFIWGVYKQSLRCVNCRFTCHYRCRALIK
LDCSQDHESIADQSDDAQDSSETDTNVDEVIDSKKQELSLSEIQQKVKEYNAQIHSNLFM
CLNKDGTYTGFIKVHLKLVRPVSVPPLRKGAASQESANGKRSGVIKRRTSFYLPKDTAKH
LHISSQTRAKEVIQALLKKFTVIDNPAKFALFERTERHEQVYLRKLSDDECPLYLRLSAG
PNEKVLSLVLKENETGDVNWDAFSMPELQNFLRILKREEEEHVKQIVQRYALARDRFQEA
LAGSNPG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtcttttggtgagttcattgagcttaaggagcttgcagtggaagatcgcattgagctg
actgctcctataccgcatcggacgcctcgtctggagagagtcaatgccttgaggataagc
cccggaaaatttcctgatctttttaatcgggtcaggattatcaggctactgggagacagt
atgaaagatccacgattggtagaggagacaggagagggccataacttccagccatgcagc
catgcccaacccacctggtgtgacttgtgtggcgacttcatctggggagtatacaaacaa
agcctgcgttgtgtcaactgtaggttcacttgccattaccgctgtagagctctcattaaa
ctggactgcagtcaggatcatgaatctattgctgatcaatctgatgatgcccaagatagc
agtgaaacagacaccaatgtggatgaggtaattgacagtaagaaacaagaattatcactt
tcagagatccagcagaaagtaaaggaatataatgcgcagatccatagcaacctcttcatg
tgtttgaacaaagatggcacctacactggctttattaaagttcatctgaagcttgtacgg
ccagtttctgtcccacctctacgcaaaggtgctgcgtcccaggagtcggccaatggaaag
aggagcggagtaataaagagacgcacatccttctaccttcccaaggacacagccaaacac
ctacatattagctctcagacccgtgccaaagaagtgatccaggccctgctcaagaagttc
accgtcattgacaatcccgccaaatttgcactgtttgagcgcactgagcgtcatgagcaa
gtgtacctacggaagctctctgatgacgagtgtccactttacctgcgtctgtctgctggc
cccaatgagaaggtgctgagtctggtgctgaaggagaatgagactggagatgtcaattgg
gatgcgttttctatgccagagcttcagaatttcttacgcattctgaagcgagaggaagag
gaacacgtaaagcaaattgttcagcgttatgctctcgcccgtgatcgtttccaggaggct
ctggctggctccaacccaggctga

DBGET integrated database retrieval system