KEGG   Electrophorus electricus (electric eel): 113571129Help
Entry
113571129         CDS       T05787                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00020  Citrate cycle (TCA cycle)
eee00190  Oxidative phosphorylation
eee01100  Metabolic pathways
eee01200  Carbon metabolism
Module
eee_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eee_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eee_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113571129
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113571129
Enzymes [BR:eee01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113571129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 FAD_binding_3 Thi4 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 113571129
NCBI-ProteinID: XP_026855725
LinkDB All DBs
Position
Unknown
AA seq 218 aa AA seqDB search
MAAVFSASRVLGKKILPSKPLLTFCPAIRKLHFYINGKRGDAKVTDAMSMHYPVVDHEFD
AVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDDWRWHF
YDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGRVSTLCNCFLQELVN
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggtgttcagtgcttcacgtgtcctaggcaaaaagatcttgccatcaaagccg
ctactgacattttgcccagccatcagaaaacttcacttttacattaatggaaaacgtgga
gatgctaaagtcacagacgctatgtccatgcattacccagtggtagatcatgagtttgat
gctgttgtggtgggggcaggtggtgcaggattgcgggctgcgtttggactatcagaggct
ggcttcaatacagcatgtgtcaccaagctgttccccacacgctctcacacagtagctgca
cagggtggaatcaatgctgcccttggcaatatggaggaagatgactggcgctggcatttt
tatgacacagtaaaaggatctgattggttgggagaccaggatgccattcactacatgaca
gaacaggcccctgctgcagtggttgagctggagaactttggcatgcctttcagccgaaca
gaggatggaaagatctaccagcgtgcttttgggggacagagcttaaagtttgggaaggga
ggccaggctcataggtgttgttgtgtagctgacaggacaggtcattctcttctgcacact
ctttatggacgggtgagtacactctgtaattgttttttgcaagaattggtaaactga

DBGET integrated database retrieval system