KEGG   Electrophorus electricus (electric eel): 113572237Help
Entry
113572237         CDS       T05787                                 

Gene name
pln
Definition
(RefSeq) cardiac phospholamban
  KO
K05852  phospholamban
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04020  Calcium signaling pathway
eee04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    113572237 (pln)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113572237 (pln)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eee02000]
    113572237 (pln)
Transporters [BR:eee02000]
 Other Transporters
  Pores ion channels [TC:1]
   113572237 (pln)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholamban Sarcolipin Baculo_11_kDa
Motif
Other DBs
NCBI-GeneID: 113572237
NCBI-ProteinID: XP_026857444
LinkDB All DBs
Position
Unknown
AA seq 52 aa AA seqDB search
MEKVQHITRAALRRASTMEVSQHAKRNMQELFVNFCLILICLLLIYIIVLLM
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggtacagcacatcactcgcgccgccctccggagggcgtccaccatggaggtg
tcccagcatgccaagcggaacatgcaggagctctttgtcaacttctgcctcatcctcatc
tgcctgctgctcatctacatcatcgtcttgctaatgtga

DBGET integrated database retrieval system