KEGG   Electrophorus electricus (electric eel): 113572522
Entry
113572522         CDS       T05787                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04012  ErbB signaling pathway
eee04068  FoxO signaling pathway
eee04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113572522
   04068 FoxO signaling pathway
    113572522
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113572522
SSDB
Motif
Pfam: CDI Dmrt1
Other DBs
NCBI-GeneID: 113572522
NCBI-ProteinID: XP_026857979
LinkDB
Position
Unknown
AA seq 199 aa
MWKMSNVRLSNGSPPLERVDARLADHTKPPVCRNLFGSVDPEEFRRDYLEQLQEMEKADT
EKWNFDFSKNEPLSPGKYEWEEVDGKDLPDFYTRPPHNVKRAPTAGTVDHNGNRSCLLRT
PSQESGGGHSENTAAESRSDYRETRAAARKRPSSEDRGKWRLDSPCQSKRSNNDTEEANH
CPDMSRSVEQTPRKSDHKT
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtggaaaatgtcaaatgtgcgtctctctaatggaagtccaccgttggaaagggtggat
gcgaggcttgcggatcacaccaagccaccggtgtgcagaaacctttttggatctgtggat
ccagaagaatttagaagggattatttagagcagttgcaggagatggaaaaggcagacacg
gagaagtggaattttgacttttcgaagaacgaaccgctttcaccgggcaaatacgaatgg
gaagaggtagacggcaaagacctgccagatttttacacaagaccaccacataacgtaaaa
cgggcccccaccgcagggactgtggatcataacggcaatcgcagttgtttgctgagaact
ccctcccaagagagcggaggagggcactctgaaaacacggcggcagagagtcggtcagac
taccgagaaacacgcgccgccgcgagaaaaagaccttcgtcagaggaccggggtaaatgg
aggctggattctccatgtcaaagtaaaagatcaaacaacgacacagaggaagcaaaccac
tgtccagacatgtcacgttcggtagagcagacccccagaaaatcagaccacaagacgtaa

DBGET integrated database retrieval system