KEGG   Electrophorus electricus (electric eel): 113573140Help
Entry
113573140         CDS       T05787                                 

Definition
(RefSeq) transcription factor PU.1-like
  KO
K09438  transcription factor PU.1
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eee03000]
    113573140
Transcription factors [BR:eee03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    113573140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 113573140
NCBI-ProteinID: XP_026859029
LinkDB All DBs
Position
Unknown
AA seq 247 aa AA seqDB search
MEGCVISSPSEEMIAYDQVFRPMYEFYPQLPSILDGHMETGWDYQTVHIHQSDLEVPPSS
HFTELHSAPYCYTNVESFHAPLDSGLLPVLTPQYVTLPRYECSPHAPCSTDDEDVRGRSP
PFEVSEGEEEHEEKHGASSAGVPGNKRKVRLYQFLLELLRDGDMKDCIWWVDRERGTFQF
SSKHKEMLASRWGLQKGNRKRMTYQKMARALRNYSKTGEVKKVKKKLTYQFSSEVLRKIP
VERKYHQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggagggctgtgtcatatcatctccatcagaagaaatgattgcgtatgatcaagttttt
cgaccaatgtatgagttctacccccagcttcccagcattttagatggtcatatggagaca
ggatgggactaccaaaccgttcacattcaccaaagtgacctggaggtccctccaagtagt
cacttcactgaactgcactctgccccatattgctatacaaacgtggagtcgtttcacgcc
cctctggattcaggacttctgcctgtgctcactcctcagtatgtcactctcccacggtat
gagtgctcccctcatgccccctgcagcactgatgatgaagatgtgaggggccgcagccca
cccttcgaggtgtcagaaggggaagaggagcatgaggagaagcacggtgccagctccgct
ggtgtaccaggcaacaaaagaaaagtacgtctttatcagttcctcttggaactgctgaga
gatggggatatgaaagactgtatttggtgggtggacagagagagaggcacctttcagttc
tcttccaagcacaaggagatgctagccagtcgctggggtctgcagaaaggcaaccgtaag
agaatgacctatcagaagatggccagggccttgcgaaactacagcaagactggggaggta
aaaaaggtcaagaagaaactgacataccagttcagtagtgaggtgctgcgaaagattcca
gtagaaagaaaatatcaccaataa

DBGET integrated database retrieval system