KEGG   Electrophorus electricus (electric eel): 113573558
Entry
113573558         CDS       T05787                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04012  ErbB signaling pathway
eee04068  FoxO signaling pathway
eee04110  Cell cycle
eee04115  p53 signaling pathway
eee04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113573558
   04068 FoxO signaling pathway
    113573558
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113573558
   04115 p53 signaling pathway
    113573558
   04218 Cellular senescence
    113573558
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113573558
NCBI-ProteinID: XP_026859693
LinkDB
Position
Unknown
AA seq 208 aa
MAITSSQCDHTELEGAEEDGKPPAAAAVRRNLFGPVDHLQLRQDYQRLMGKSMEEAKQRW
NFDFQRDRPVPGSVEWEELPCQDVPAFYRSCVVRADTAGRRVELAGDTSRSLGCPTVAAE
GEEYLEVRAKGVYRGAKLEKTGPTPLGFKHRQATIPDFFAVKKRRFLHQKGSRQHQDCDI
LLSEILHFLPLETPRVLKCAKFMFQQHK
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccataacctcgtcacagtgtgaccacacggaactggagggggccgaggaagatgga
aagccaccggcggcagcagctgtgcgacgcaacctgttcggccccgtggaccacctgcag
ctccggcaggactaccagaggctgatgggcaaaagcatggaggaagccaagcagcgctgg
aacttcgacttccagagggaccgcccggtgcccggctctgtggagtgggaggagctccca
tgccaggatgtgcctgcgttctaccgaagctgcgtggtgagggcggacacagccgggcgc
agggtggagctggcgggggacaccagcaggtccttgggctgtcccacagtggccgcagaa
ggagaggagtatctggaggtcagggccaaaggagtgtacagaggagccaagctggaaaag
acagggccaaccccactggggtttaaacaccgacaggcaaccatcccagatttcttcgct
gtgaagaagaggaggtttcttcatcagaaaggatcaagacaacaccaagactgtgacatt
ctactctcagaaatcctgcactttctacccctggaaacccctcgagtactaaaatgtgca
aaattcatgtttcagcaacacaaatag

DBGET integrated database retrieval system