KEGG   Electrophorus electricus (electric eel): 113575066Help
Entry
113575066         CDS       T05787                                 

Definition
(RefSeq) gap junction beta-3 protein-like
  KO
K07622  gap junction beta-3 protein
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eee02000]
    113575066
Transporters [BR:eee02000]
 Other Transporters
  Pores ion channels [TC:1]
   113575066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Connexin UbiA
Motif
Other DBs
NCBI-GeneID: 113575066
NCBI-ProteinID: XP_026862171
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MDWKTLESLLSGANKYSTGFGRIWLSLVFVFRVMVFVVAAERVWSDDHKEFDCDTKRPGC
PNACYNYCFPIIHTRLWALQLIFVTCPSFLVVMHVWYREDRERKYRLIHGEKAKLYDNPG
QKHGGLWWTYLISLFFKTGIEVGFLYLLHLLYHNFDMPRSIVCDIEPCRQVTCYIARPTE
KRVFTYFMVGASVICIILNVSEIFYLIAMRIVHLTQKGSHVPSRRRCGEPGCDSCNVVMT
SVDDKLANPEKATKQS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggattggaagactctcgaatcccttctcagtggtgcaaataaatactccacgggtttt
ggacgtatctggctgtccctggtgttcgtgttccgtgtcatggtgttcgtggtagctgct
gagcgtgtgtggagtgatgatcataaagaatttgactgtgataccaaaaggccaggctgc
cccaatgcctgttataactactgctttcccattatccacacacgactctgggccctgcag
ctcatctttgtcacctgcccttccttcctggttgttatgcatgtgtggtaccgtgaagat
cgcgagcgcaaataccgactcatccacggcgagaaggcgaagctatatgataaccctggg
cagaagcatgggggtctgtggtggacatacctcatcagccttttcttcaagacaggcatt
gaggtgggattcctctacctgctccatctgctctaccacaacttcgatatgccccgcagc
atagtctgtgacattgagccctgcaggcaagtgacatgttacatagcacgtcccacggag
aagagggtcttcacgtattttatggtgggggcctcagtcatctgcataattctaaatgtg
tctgagatcttctacttgattgctatgcggatcgtgcatctcacccagaagggcagccat
gtcccttcacgcaggagatgtggagagccaggatgtgatagctgtaatgtagtaatgacc
tctgtagatgacaaactagctaatccagaaaaagcaacaaaacaatcttaa

DBGET integrated database retrieval system