KEGG   Electrophorus electricus (electric eel): 113575554
Entry
113575554         CDS       T05787                                 

Definition
(RefSeq) glucocorticoid receptor-like isoform X1
  KO
K05771  glucocorticoid receptor
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113575554
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eee03000]
    113575554
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:eee03310]
    113575554
Transcription factors [BR:eee03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    113575554
Nuclear receptors [BR:eee03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   113575554
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 113575554
NCBI-ProteinID: XP_026862927
LinkDB
Position
Unknown
AA seq 778 aa
MDQGGVRNVKNRDECLIPLDYGDSSVEGVLRSGAHSTMSVAPTSLVPPPSPLMQPVSGDL
PNGVSNSPSSEELTINLPTSLDLYVEDPDMKMLGKDQRAQQAFQQQSVVGLYSIGDSLSR
LEASIADLNSSSPSVDSLIGGVDPSLFPLKNEDFSPMDKGDIDLEQDPFGPIGKDVDASN
TKLFGDNTMDLLQEFELAASPSDFYVGDEFATLSEESLLGVITSERDTKPAVSVSNTNGT
SATSGTTGVNGTSSSSPSGLTATSPSPVVKLEKEPLIQLYTPGIIKQENPTGRSFCQMAG
SELLSPLSAASISICGVSTSSGQTYHFGGSTSTAATNGQQKDQKPIFNVYTPQAVTGDGW
GRGFGNVTRIQQGATDSFSGSQNFTAAYGRPESSAALSTGTGKPSGSTHKICLVCSDEAS
GCHYGVLTCGSCKVFFKRAVEGWRSRQNTDGQHNYLCAGRNDCIIDKIRRKNCPACRFRK
CLMAGMNLEARKAKKLNRLKGVQQSTTAELGPAPVPETRALVPKAMPQLVPTMLSLLKAI
EPETIYAGYDSTLTDTSTRLMTTLNRLGGRQFVSAVKWAKALPGFRNLHLDDQMTLLQCS
WLFLMSFSLGWRSYQQCNGNMLCFAPDLVINEDRMKLPYMGDQCAQMLKISNEFVRLQVS
NEEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVRREENSSQNWQRFYQLT
KLLDSMHDMVGGLLNFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSVKPLLFHQK
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggatcaaggaggtgtgaggaatgtcaaaaacagagatgagtgtttgattcccctcgac
tacggcgacagctcagttgagggagttctccgcagtggcgcacacagcaccatgtccgtt
gccccaacctctctggttcctccgcccagccccttaatgcagcctgtgtcaggagacctt
cccaatggagtcagcaattcaccctcttcggaggagctcactatcaatttaccaacctcc
ctggacctctatgtggaggatccagacatgaaaatgttagggaaggaccaaagggctcag
caggccttccagcagcagtcggtggtgggcctctacagtattggggacagcctctcacgg
ctggaggccagcattgcagatctcaacagctcctccccatcggtggactcccttatcgga
ggggtggatccaagtcttttccctctgaaaaacgaggacttctctcccatggataaaggg
gacattgatctggaacaggatccatttgggcctattgggaaagatgtggatgctagcaac
accaagctctttggtgacaacaccatggacctcctgcaggagtttgagttggctgcgtcg
ccgtccgatttctacgtgggagacgagtttgccaccttgtctgaggaatccctgctggga
gtcatcacttctgaaagggatacaaagccagcagtttccgtgagcaacaccaatggcacc
agtgccaccagtggcaccaccggcgtcaacggcacctccagctccagtccttctggcctc
actgcaaccagcccttcccctgtggtcaagttggagaaagaacccctgatccagctctac
actccggggatcatcaaacaggagaaccccactggaaggagcttctgtcagatggctggt
tcagagctgttgagcccgctcagtgcagcgtccatctccatctgtggcgttagcacctcg
agcggacagacttaccactttggaggctccacctccactgcggccaccaacggtcagcag
aaagatcagaagccaattttcaacgtatacacaccacaggccgtcacgggggatggctgg
gggagaggatttggaaacgtcaccaggatacaacaaggggccactgacagctttagtgga
agccagaacttcacagctgcctatggcaggccggagtccagcgccgccttgtccacaggc
acagggaaacccagcggcagcacacacaagatctgcctggtgtgttcagacgaggcctct
ggctgccactatggagtgctaacctgtggcagctgcaaggtcttcttcaaacgtgcggtg
gaaggatggcgttcgagacagaacacagatgggcaacataattacctgtgcgcaggaagg
aacgattgcatcatcgataaaatccgcaggaagaactgccccgcttgccgcttccgcaag
tgcctcatggccggcatgaacttggaagcacgtaaggccaagaagctgaaccgcttaaag
ggtgtgcagcagtcgaccacggccgagctgggccctgcccccgtgccagaaacgcgggca
ctggtgcccaaggctatgccccagcttgtgcccaccatgctgtcccttctcaaagccatc
gagcccgagaccatttacgctggctacgacagcaccctgaccgacacctccactcgcctc
atgaccaccctgaacaggctgggtgggcggcagttcgtctcggcagtgaagtgggctaaa
gctttgccaggtttccggaaccttcacctggatgaccagatgaccttgctgcagtgttcc
tggcttttcctgatgtctttcagtttgggatggaggtcctaccagcagtgcaatggcaac
atgctctgttttgccccagacctggtgataaatgaggacaggatgaagctgccctacatg
ggtgaccagtgtgcacagatgctcaagatctccaacgagtttgtgaggctgcaggtgtcc
aatgaggagtacctgtgcatgaaggtgcttctgctgctcagcacagtgccaaaggatggt
ctgaagagccaggctgtgttcgatgaaatcaggatgtcctacatcaaagaactgggaaaa
gccattgtccggagagaggagaactccagccagaactggcaaagattctaccagctcact
aagctactggactccatgcatgatatggtgggaggactgttgaacttctgcttctacacg
ttcgtgaacaagtccttgagtgtggagttccctgagatgctcgctgagatcatcagcaac
caattaccaaaatttaaagccgggagtgtcaaacctttgctctttcaccagaaatga

DBGET integrated database retrieval system