KEGG   Electrophorus electricus (electric eel): 113575949
Entry
113575949         CDS       T05787                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04010  MAPK signaling pathway
eee04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113575949
   04012 ErbB signaling pathway
    113575949
SSDB
Motif
Pfam: UPF0560 EGF Laminin_EGF hEGF
Other DBs
NCBI-GeneID: 113575949
NCBI-ProteinID: XP_026863599
LinkDB
Position
Unknown
AA seq 212 aa
MYRAFWDTIFLIVGSLLTYGQVLENSTSLTTMALAPTTTITAESAISSTARASTTAVIRS
KLWLTAVHSHFADCPESHSHFCFHGTCRFLIVEETPACVCQPGFIGMRCEHADLLAVVAT
NHTQHTVATMLVLCVVASVLLILLCTLLNCCWRRGACRQRHNLSHFSEKPNRIIKGGTSF
CHPETAPWTQSRAKPIVFAIGLEPLGSAWLSL
NT seq 639 nt   +upstreamnt  +downstreamnt
atgtatcgtgctttttgggatacgatatttctcattgttggctctttgcttacatatggg
caagtactagaaaattctacctcactaacaactatggcattggctcccacaaccaccatc
accgcagaaagtgctatcagcagcacagctagagcaagcactaccgctgttatccgaagt
aagctctggcttactgcagtccactctcactttgctgactgccctgagtctcatagccac
ttctgcttccacggtacatgccgctttctcattgtggaggagacgcctgcttgtgtatgc
cagccaggcttcatcggtatgcgttgtgaacatgcagatctattggccgtggtggcaact
aatcacacgcaacatacagtggccaccatgttggtgttgtgtgttgtggccagtgtcctg
ctcattctgttatgcactttgctaaattgttgttggaggcggggtgcttgtaggcaacgc
cacaacctttcccatttctcagaaaagccaaatagaatcatcaagggtgggacatccttc
tgtcacccagagacagccccatggacgcagtcgcgtgccaaacccattgtgtttgcaata
ggattggaacctcttggatctgcctggctgagcctttaa

DBGET integrated database retrieval system