KEGG   Electrophorus electricus (electric eel): 113576556
Entry
113576556         CDS       T05787                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04010  MAPK signaling pathway
eee04020  Calcium signaling pathway
eee04260  Cardiac muscle contraction
eee04261  Adrenergic signaling in cardiomyocytes
eee04270  Vascular smooth muscle contraction
eee04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113576556
   04020 Calcium signaling pathway
    113576556
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113576556
  09153 Circulatory system
   04260 Cardiac muscle contraction
    113576556
   04261 Adrenergic signaling in cardiomyocytes
    113576556
   04270 Vascular smooth muscle contraction
    113576556
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:eee04040]
    113576556
Ion channels [BR:eee04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   113576556
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 113576556
NCBI-ProteinID: XP_026864486
LinkDB
Position
Unknown
AA seq 2302 aa
MLRRIFQRRLKHERLQEEPEVRFKGKLISEKDLGYTYVRPGGSNYSSPSLAPVASLNEQE
HSSGSGGGGRGGVVGLAPEHIPTPGAALSWQAAIDAARQAKLMGKAGAPISTASSTQRKR
QHYSKPKKQTTTAATRPPRALLCLTLKNPIRRACINIVEWKPFEIIILMTIFANCVALAV
YIPFPEDDSNATNFNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIV
VVGLFSAILEQATKGDGGTPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIK
AMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFIRDGQKGAIAEEKPAPCAPNSSA
HGRHCSPPNITQCYMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYE
LPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLD
WITQAEDIDPENDDEGLDDDKPRNRKTRLQYFRGAVKKKAAVLLSIPASENESVNTDNAP
AGDMEGETCCTRLANRISKSKFSRYSRRWNRLCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHHQQPDWLTNVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDGFVVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGP
SFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERRKLARMA
SPEKQQDNEKPPVEEEKREEKIELKSITSDGETPTTTKINIDDYTGDDNEEKNPYPVNDF
PGEEDDEEPEMPVGPRPRPLSEIQLKEKAIPMPEARAFFIFSHTNKFRVLCHKIVNHNIF
TNLILFFILLSSVSLAAEDPVKSDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKG
SFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCV
FVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFSYCTDSSKQTEAECKGTYILYKDGNVG
KPERAQRIWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYKAIDSHAEDVGPIYNYRVVI
SIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRY
IPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSTSFNNAMNILNMLFTGLF
TVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINHYFVDAWNTFDALIVVGS
VVDIAITEVNPADPSSSTPSSVVRPMGQQNTEDNARISITFFRLFRVMRLVKLLSRGEGI
RTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALRDNSQINRNNNFQTFPQAV
LLLFRCATGEAWQEIMLACSPHHPCEKGSDESPTTEDCGSYFAIIYFVSFYMLCAFLIIN
LFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLG
FGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGKIRHLSYTVKIIY
YLTYKVKIVQYSNKLLCVCVCVCVCMFVILLQGNLEQANEELRAIVKKIWKRTSMKLLDQ
VVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHDMGP
EIRRAISGDLTVEEELEKAMKETVCAASEDDIFRVKRSGGLFGNHVNYYHQSDGRTSFPQ
SFTTQRPLHISKSGSPGEGESPSHEKLVDSTFTPSSYSSSGSNANINNANNTAIGHCYPS
PSISTVDGHTRPLLTPVLLPHSSWCFPNKSLDTSESRLPIIRREEASTDETYDEMFTESN
CDQSMLSTEMLALQDEECKQLAVTGEGDVGEDRRPWQSPRRAFLCPTALGRRSSFHLECL
RRQTRADPSQKTALSLHLVQHQALAVAGLNPLVRRSHSPTLFTRLCSTPPASPCSHGAGG
LCEQPVPSLRLEEPGSYEKLNSSLPSVNCGSCPSDSNGHDTRSSRRALRPISLTVPSVTC
KETGSFSHGSAGSLVEAVLISEGLGRYAQDPSFIEVAKQELADACDMTMEEMENAADNIL
NANGPPSPNGNLLPYMHCRDTGTPEPLRSNSQGLSRAGETEELLRSGLEDLEKGTGGLRA
AGGGQRNSRLMEDEDMECVTSL
NT seq 6909 nt   +upstreamnt  +downstreamnt
atgctacgcaggattttccagcggagactgaagcatgaacgcttgcaggaggagccagaa
gtgcgatttaaagggaaactcatctctgagaaagacctggggtatacgtatgtacggcca
ggaggttccaactactccagcccatctctggctccggtggccagtctgaatgagcaggag
cacagcagtggtagcggcggtgggggcagaggtggcgtggtaggtttggctccggaacac
atccccacaccaggtgccgctctcagctggcaggcggccatcgacgctgcaaggcaggcc
aagctgatgggcaaagctggggcccccatctccacagccagctccacccagcgcaagagg
cagcactacagcaagcccaagaaacagaccaccacagcggccacacggccaccacgtgcc
ctactttgtcttaccctcaagaaccccatccgcagagcctgcatcaacattgtggagtgg
aaaccctttgaaatcatcattttgatgactatttttgctaactgcgtggccttagctgtc
tacatccccttcccagaggacgactccaatgccaccaacttcaatctggagcgagtagag
tatctgttcctcatcatctttacagtggaggcttttctgaaggtgattgcctatggtcta
ctgtgtcaccccaatgcctatctgaggaatggctggaatctgctggactttatcatcgtg
gttgtagggttgtttagcgctatattagagcaggccacaaaaggggatggaggaacgcca
ataggaggaaaagcagcagggtttgatgtaaaggccctacgagcattcagagtgctgaga
cctctacgactggtgtccggagtgcccagtttacaggtggtgttgaactccattattaaa
gccatggttcccctgttgcacattgccctcctcgtcctctttgtcatcatcatctatgcc
atcatcggtctggaactcttcatgggaaagatgcaccgcacatgctttttcatcagagat
ggacagaaaggtgctatagctgaagagaagcctgcaccctgtgccccaaactcatcggcc
catggacgtcactgttccccacccaacatcacacagtgctatatgggatgggaggggcca
aatgacggaatcacaaactttgataactttgcatttgccatgctgacagtgtttcagtgc
atcactatggagggctggactgacgtcctctactggatgcaggatgctatgggctatgaa
cttccctgggtgtattttgtcagtctcgtcatctttggatcctttttcgttctaaatctg
gttctgggggtgttgagcggagagttctctaaggagcgtgagaaggcgaaggctcgtgga
gatttccagaagttgcgtgagaagcagcagcttgaggaggacctgaagggctacctggac
tggattacacaggctgaggacattgacccagagaacgatgatgaaggactggacgatgac
aaaccccgaaaccggaagactcgtttacagtactttcgtggagcagtgaagaaaaaagca
gctgtacttttgagtattccagcaagtgagaatgagtcagtgaatactgataatgctcca
gctggagacatggagggagaaacttgctgtacacgcctagcaaataggatctccaaatcc
aaattcagtcgatattcacgccgttggaatcgtctgtgccggcgtaagtgtcgggctgca
gtaaagtcaaatgtgttttactggctggtgatttttttagtgtttctgaacactctcacg
attgcatcagagcatcatcaacaaccagactggctcacaaatgtacaagatattgccaac
aaggttctcttggctctctttactggcgagatgcttctgaagatgtacagtttgggacta
caggcatattttgtctccctttttaaccgttttgatggctttgtggtatgcggtgggatc
ctggagaccatcttggtggagacaaagatcatgtcacctctgggtatctcagttctgcgt
tgtgtgcgtctgcttcgcatcttcaaaatcactaggtactggaactctctcagcaacctg
gtggcatctttgctgaactctgtccgctccattgcttccctgctgctgctgctcttcctc
ttcatcataattttcagtttgcttggcatgcagctgtttggtggaaagttcaactttgat
gagacacgtcgcagcacctttgacaactttccccagtctttactcacagtctttcagatt
ctgactggagaggactggaactcagtgatgtatgatgggattatggcatatggagggcca
tcatttcctggcatgcttgtttgcatctactttatcattctcttcatctgtggaaattac
atcctcctgaatgtattcttggccattgctgtggacaacctggcggatgcagaaagcctg
acatcagctcagaaagaggaagaggaagagaaggagaggaggaagctagctagaatggct
agtccagagaagcagcaagacaatgaaaaacctccagtagaggaagaaaaacgagaggag
aagattgagctgaaatcaatcacctcagatggagaaacaccaacaaccaccaagataaac
atcgatgactacacaggagatgataatgaggagaagaatccatatccagtaaatgacttc
ccaggggaggaagatgatgaagagccagagatgccagttggtccaaggccacgaccactt
tctgaaattcagctgaaggagaaagccattcccatgcctgaggccagagccttcttcatc
ttcagccataccaacaagtttcgggttttgtgtcataagattgtgaaccacaatatcttc
accaatctcatcctcttcttcattctgctgagcagcgtctctctggctgcagaggaccca
gtgaagagtgactcattcagaaatcagattctaggctatgcagatcatgtgtttacaggt
ctctttacaatagagatcatattaaagatgacagcatatggagcattcctccataagggt
tctttctgtcgtaactactttaacattctggatctggtggtggtcagtgtttctctcatc
tcctcagggattcagtcgagtgccattaatgtagtaaagattttgagagttcttagagtc
ctcagacccttgagggccatcaacagggccaagggcctcaaacatgtggtgcagtgtgtg
tttgtggcaatccgcaccattgggaacattgtcatcgttaccactctgctgcagttcatg
tttgcttgtattggagtacagctctttaagggcaaattctcttactgcacagactcttcc
aaacagacggaagcagaatgcaaggggacttatatcctgtataaagatggtaatgttggc
aaaccagagagagctcagcgtatctgggagaacagtgacttcaacttcgatgatgttttg
caaggcatgatggccttgtttgctgtatccacttttgagggatggccagggctcctatac
aaagccatagactcccatgctgaagatgtaggacccatctacaactaccgtgtggtcatc
tccatcttcttcatcatctacatcattatcatcgccttcttcatgatgaacatcttcgta
ggttttgtcattgtcacgttccaggagcagggcgagcaggagtataagaactgcgagttg
gacaagaaccagcggcagtgtgtggagtatgcactaaaggcacgaccactacgcaggtac
attcccaaaaacccataccagtataaggtatggtacgtggtcaactccacctactttgaa
tacctgatgtttaccctaatcctactcaacaccatctgcttggcaatgcagcaccatggt
cagtccacgtccttcaacaatgccatgaacatcctcaacatgcttttcactggtctgttt
actgtggagatgatcctcaaactcattgccttcaagcccaggggttactttagtgacccc
tggaatgtttttgacttcctcatcgtaattggcagcattatagacgtcattctgagtgaa
ataaatcattattttgtcgatgcatggaatacatttgacgctctcatagtagtgggtagc
gttgttgacatagctatcacagaggttaacccagctgatccgtcctcctccaccccttcc
tctgtggtaagaccaatggggcaacagaacactgaagataatgcccggatctccatcacg
ttcttccgactctttcgagtgatgagactggtgaagctgctatctcgtggagaaggaatt
cggaccctgttgtggaccttcatcaaatccttccaagctcttccatatgtagcattgctt
attgtaatgctctttttcatctacgctgttattggaatgcaggtgtttggtaaaatagca
ctgagagacaacagtcagatcaaccgaaacaacaactttcagaccttcccacaagctgtt
ctcctgctcttcaggtgtgcgacaggagaggcatggcaggagattatgctagcctgctcc
cctcaccacccttgtgagaagggctctgatgagagtcctaccactgaggattgtggcagt
tactttgctatcatctactttgtcagtttctacatgctttgtgcctttctaattatcaac
ctgtttgtggctgtcattatggacaactttgactatctgacacgtgattggtcaatcctg
gggccacatcatctggatgagttcaagaggatatgggcagagtacgaccctgaggccaaa
ggaaggataaagcatctggatgtggtgacattactgaggaggattcagccaccactgggc
tttggcaaactctgtccccatcgagtagcttgcaagcgcctggtgtccatgaacatgcct
ctgaacagcgatggcaccgtaatgttcaatgctactctgtttgccctagtgcgaaccgcc
ctccgcattaaaaccgaaggtaaaataagacatctctcatacactgtcaaaattatctat
tatttgacttacaaagtaaaaattgttcagtattctaataaattattgtgtgtgtgtgtg
tgtgtgtgtgtgtgtatgtttgtgatactactccaaggtaacttggagcaggcaaatgaa
gaactgagggccatagtaaagaaaatctggaagaggaccagtatgaaattgctcgaccag
gttgtacccccagctggagatgatgaggtgacagtgggaaagttctatgccacattcctt
atccaggaatacttcaggaagttcaagaagcggaaggagcagggcttggtggctaaagtg
cctccaaagactgctctttctttgcaggcaggcctgcgtacactgcatgacatgggtcca
gagattaggagggcaatatctggggacctaaccgtggaggaggagctggagaaggccatg
aaggagacggtgtgtgcagcatctgaagatgatatcttcagggtaaagcgatctggaggt
ctatttggaaaccacgtaaattattaccatcagagtgatggccgtacctcctttccacaa
tcctttacaactcagcggccactgcacatcagcaagtcaggcagccctggagagggagag
tccccgtcgcatgagaaacttgtggactccaccttcaccccaagcagctattcctcctca
ggttccaatgccaacatcaacaatgccaacaataccgccattggacactgctacccgagc
ccctccatcagcactgtagatgggcacaccagacctctgctcacacctgtactgctgcct
cactcctcatggtgcttccctaacaagagcttggacacgagtgagagtcgtctccccata
atccgccgggaagaggcatccacagatgaaacatatgacgagatgtttacagagagcaac
tgtgaccagagcatgctctccacagaaatgttggctttgcaggatgaagagtgtaagcag
ttagctgtgactggggaaggggatgtgggagaggacagaagaccatggcagtctcctcga
cgagcctttctctgtcctactgcactcggtcgacgatcttcctttcatttagagtgtctg
aggagacagaccagagctgatccttctcaaaagacagcactatccttgcacctggttcag
caccaggcactggcggtagcagggttgaaccccttggtgaggaggagtcattctcctact
ttgttcacacgtctgtgttccacacctcctgccagtccttgcagccatggggcaggtggg
ctatgcgaacagcctgtgccctcactgaggctagaggaaccgggctcctatgagaagctc
aacagcagcctaccatcagttaactgtggctcatgcccaagtgacagtaacggacatgat
acaaggagctctcggagagcactgcgtcccatctctctaacagtgccatctgttacatgc
aaagaaacaggctcattctcacatggcagcgctggcagtcttgtggaagcggtgttgata
tctgaggggctgggccgttatgcacaggacccctctttcatcgaggtggcaaagcaggag
cttgctgatgcttgcgacatgaccatggaggaaatggagaatgcggcagataacatacta
aatgccaatgggcctccaagccctaatggcaaccttctgccctatatgcactgcagggat
actgggaccccggagccactgcggagcaacagccaggggctgtccagagccggggagaca
gaggagctgctgaggagtggcctggaggatcttgagaaagggacaggggggctgcgggca
gctggggggggtcaacggaacagtcggctgatggaggatgaggacatggagtgtgtgacc
agcttgtag

DBGET integrated database retrieval system