KEGG   Electrophorus electricus (electric eel): 113576802Help
Entry
113576802         CDS       T05787                                 

Gene name
caskin2
Definition
(RefSeq) caskin-2 isoform X1
  KO
K21952  CASK-interacting protein
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eee04131]
    113576802 (caskin2)
Membrane trafficking [BR:eee04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    113576802 (caskin2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 SAM_1 Caskin-Pro-rich Ank_5 SAM_2 Ank_4 Caskin-tail Ank Ank_3 Caskin1-CID SH3_2 SH3_9 SH3_1
Motif
Other DBs
NCBI-GeneID: 113576802
NCBI-ProteinID: XP_026864913
LinkDB All DBs
Position
Unknown
AA seq 1306 aa AA seqDB search
MGKEQELLQAVKNGDLLSTQKILAKLKTSRSKLLGSTKRLNVNYQDSDGFSALHHAALTG
TTDLLSLLLEAQATVDIKDSNGMRPLHYAAWQGKADSVLTLLKAGALVNGASQDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSNMITTLLEGD
RKDTVDSVFNTPLHLAARNGHKDIIRLLLKAGIDINRATKAGTALHEAALYGKTEVVRLL
LDAGIDVNIRNTYNQTALDIVNQFTTSHASKDIKQLLRDATGVLQVRALKDYWNLHDPTA
LNIRAGDIIMVLEQHMDGRWKGHIHDSQRGTDRVGYFPPSIVEVMSRRCGGTLLRHCSLP
CQRQQQQLSRAPLTSNLSMSTSVTPQTDDSYTLYVPNPHLALAHSSGLTTNPGGPPSSLS
QPTFPCLEDIWVLRNSDIAGDRNSVGSTGSVGSTRSAGSGQSTESNCTPNGPHLHTTNPD
ANKQPAPPGGDAIPTDQHKQPDQSTAIPRRPVLAVARAPEPGFSQQFVRPQQLLEGKDAE
AIYQWLSDFQLEQYTANFLNAGYDVPTISRMTPEDLTAIGVTKPGHRKKISLEIGNLSIP
EWLPEYTPADLGEWLSAIGLPQYHKKLLENGYDSISIVRDLTWEDLQEIGITKLGHQKKI
MLAVKKLCDLHKALLQAESGQGTLRRNAPMALDLLPIEPPAADGNLPSPHTPKMLTFQDS
ELSAELQSVMATHYSGTQDGLAIKNATAMSASQESIDARSRGSGRSQEPSVTSSSSSATT
PHSRSQESLTNADSSPVKERNIPEGRDQQQRAVGGSPGFKYPPVHAKPSQGASSSQKAFS
YLHANSGSAILDRHSPGVPKKRMQSLKRYALSDGEPDEEDDEESVRPTINALPSYATLSR
RSGRGQMARLQSAPEQSIGRSQSFAIRARRKGPPPPPPKRLSSVTNSNPSGEVVPDSQAP
PAGRVEADSPGNVKSIAATLEMVLMGPRAELHQEVNTSLSTSTEGSRRRALSQSEPSPAP
QVEADRSIKSDSEEDESAKDASLDSSSSPQNSSSECIPFAEEGNLTIKQRPKVSGPAKAD
DFVEPPEKPQAAKEHEIPEFNLKESDTVKRRHKPKEKEQPTTVGGASEDDELQGPGLVNL
HISVTEITPSCPGPPTAQPATAPPPLAPKPASPPKPPHHTTNLTQPEPPTTVGGSSVTLN
VIQSVAFTAPPSPVPCSPVAGPVIQAIAPEQYQTCLEAGPGAVQVQRRLDQTSSSLEEAL
KAVERKLTLEDMTDGGCQTVKSAGNILDDIGNMFDDLADQLDAMLD
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggaacaggagcttctgcaggcggttaagaacggtgacctgctctccacacaa
aaaatacttgcgaagctcaaaaccagcagaagcaagttgttaggctcaaccaagaggcta
aatgtcaactatcaggattcggatggattttcagcattacaccatgctgctctgacaggt
accacagacctgctctccctgctgctagaggctcaggccactgttgacatcaaggacagc
aatggaatgcgtccgctgcattatgccgcgtggcaggggaaggctgactctgtgctgaca
ctactcaaagcgggagccttggtcaacggagcatcgcaagatggtcagatcccattgcat
cttgctgcgcagtatggacactacgaggtgtctgagatgctcctacagcaccagtccaat
ccctgcctagtgaataaggctaagaaaacgcctctggatttggcctgtgaatttggcagg
ctgaaggttgcccaactgttgttgaacagtaacatgattaccactctgttggagggggac
cggaaggacactgttgactccgtgttcaacactcccctccacctcgccgctcgcaatggc
cataaggacataattcggttgttactaaaagcaggaattgacatcaacagagccaccaaa
gcaggcactgctttgcatgaagctgccctctatgggaagactgaggtagtgaggctactg
ctggatgctggcattgatgtcaacatccgtaacacgtataaccagacagccctggacatc
gtcaatcagttcacaacctcccatgccagcaaggacatcaaacagcttttacgagatgcc
acaggagtacttcaggtgagagctctgaaggactactggaacctccatgaccctactgcc
ctcaacattcgtgctggagacatcattatggtgctggagcagcacatggacggccgctgg
aagggtcacatccatgacagtcagcgaggcacagaccgtgtgggctacttccctccgtct
atagtggaggtcatgagccgacgttgtgggggcaccctgttgcgccactgctctctgccg
tgccagagacagcagcagcagctttccagagcacccctcacctccaacctcagcatgagc
acctcagtcaccccccaaactgatgactcctacactctgtatgtccctaacccccacctg
gctctggcccattccagtggcctgaccactaacccaggtgggcctcccagcagcctctcc
caacctactttcccctgcctcgaggacatttgggttctgaggaactccgacatcgcagga
gacagaaacagcgtgggcagcactggcagtgttgggagcacgcggagtgccggtagtgga
cagagcacagagagcaactgtacacccaatggcccacacctgcacaccaccaaccctgat
gccaacaagcagccagcaccccctggtggtgacgccataccaaccgatcagcacaaacag
cctgaccagtctacagccattcctcggaggccagtgcttgctgtggcaagagcaccagag
cctggtttctcgcagcagtttgtacgacctcagcagctgctggagggcaaggatgctgaa
gcaatctaccagtggctgagtgacttccagttggagcagtacactgccaatttcctcaac
gctggatatgacgtccccaccatcagccgaatgacccctgaggatcttactgctattggt
gttacaaagccaggtcaccggaagaagatctcattggagatcggaaacttgagtatccca
gagtggctgcctgaatacacaccagcggacctgggtgaatggctcagtgctataggtctg
cctcagtaccataagaagctcttggagaatggctatgactccatcagcattgtccgggac
ctcacatgggaggatctacaggagatagggatcaccaagctaggccatcagaagaagatc
atgctggcagtgaagaagctttgtgatttacataaggccctcctccaggctgaatcaggt
cagggcacactgcgccgcaatgcgcccatggcccttgacctgctccccattgagccacct
gctgccgatggcaacctcccttccccgcacacccccaaaatgctcaccttccaggacagc
gagttgagcgccgaactgcagagtgtcatggccacacactatagcggcactcaagatggc
ctggccatcaagaatgccacagctatgtctgctagccaggagagcattgatgctcgctcc
cgaggctcaggtcgatcacaggagccttccgtcacatcctcttcctcctcagccacgacc
cctcacagccgatcgcaggagagtctgaccaatgctgacagcagccctgtgaaagagcgg
aacattccagaaggccgggaccagcagcagcgtgctgtggggggctccccaggctttaag
tatcccccagtacatgccaagccctcacagggtgcctcttcatcccagaaggctttcagc
tacttacatgcaaacagtggcagtgccatcctggaccggcactcacctggagtccccaag
aagcgcatgcagagtctaaaacgctacgctttgtccgatggcgagcccgatgaggaggac
gatgaagagtcagtccggcccaccatcaacgccctgccttcctacgccaccctgagccgc
aggtcaggccgtgggcagatggcccgccttcagtctgcccccgagcaatcaattggccgc
agtcaatcgtttgccatcagggcccggcgcaaaggaccaccccctcctcctccaaagcgc
cttagctccgttaccaacagcaaccccagtggcgaagttgtgccagactcccaagcacca
cctgcaggcagagtggaggctgacagccctggcaatgtaaagagtatcgcagctacttta
gaaatggtcttaatgggcccaagggcggagctccaccaggaggtcaacacctcactttcc
acctccaccgagggatccaggagacgagcactgagccaaagcgagcccagcccagctcca
caggtggaagcagatagatcgatcaagtcagactctgaggaagacgagagtgccaaggat
gctagccttgacagctcatcctccccccagaacagttccagtgagtgcatcccctttgct
gaagaaggcaatctcaccatcaagcagcggcccaaggtgagcgggccggccaaggctgac
gactttgtggagcctcccgaaaagccccaggctgccaaggagcatgaaatcccagagttc
aacctaaaggagtcagacacagtgaagagacggcacaagccaaaagagaaagagcagcca
acgactgtgggcggggccagtgaagacgatgaattgcaggggccgggcttggtcaacctg
cacatcagcgtgaccgagatcactccatcctgcccagggcctccaacagcacagccagca
acagcacccccacctcttgccccaaaaccagccagtcctccaaaacctccacatcacacc
actaatctcacacagcctgaacctccaaccacagtgggaggatcgagtgtgacgctgaat
gtgatacaaagtgtggcgtttacagcacccccatctcctgtgccatgttccccagtggct
gggcctgtgattcaggctattgcaccagagcagtaccagacctgtttggaggctggtcca
ggggctgtgcaggtgcagcggcggctggatcagacaagttcgtctctggaggaggcactg
aaagccgtggagaggaagctcaccctggaggacatgactgacggagggtgccaaacagtg
aaatctgcagggaacattctggatgatatcgggaacatgtttgatgatctggcagatcag
ctggacgccatgctggactga

DBGET integrated database retrieval system