KEGG   Electrophorus electricus (electric eel): 113578962
Entry
113578962         CDS       T05787                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04068  FoxO signaling pathway
eee04110  Cell cycle
eee04115  p53 signaling pathway
eee04218  Cellular senescence
eee04310  Wnt signaling pathway
eee04340  Hedgehog signaling pathway
eee04371  Apelin signaling pathway
eee04510  Focal adhesion
eee04530  Tight junction
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113578962 (ccnd1)
   04340 Hedgehog signaling pathway
    113578962 (ccnd1)
   04371 Apelin signaling pathway
    113578962 (ccnd1)
   04068 FoxO signaling pathway
    113578962 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113578962 (ccnd1)
   04115 p53 signaling pathway
    113578962 (ccnd1)
   04218 Cellular senescence
    113578962 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113578962 (ccnd1)
   04530 Tight junction
    113578962 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 113578962
NCBI-ProteinID: XP_026868340
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLFCCEVDTIRRAYQDANLLNDRVLQTMLKTEENYLPSPNYFKCVQKEILPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSIRPCELLQMELLALNKLKWDLAAVTPHDFIEHFLTKLPIHQSTKQILRK
HAQTFVALCATDVNFIANPPSMVAAGSVAAAVQGLYLKSSNGSLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLELSLRQAQQHSISTETKRVEEDADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagctgttttgctgcgaagtggataccattagaagagcttaccaagacgca
aacttgttgaatgaccgagttttacagacaatgcttaaaacagaggaaaattatcttcct
tcgccaaattatttcaaatgcgttcagaaagaaattttacccaaaatgagaaaaatcgtc
gccacatggatgctcgaggtgtgtgaagaacagaaatgtgaagaggaggttttcccgttg
gctatgaactacctggacagatttctatctgtagagcccactaaaaagaccagattacag
ttgctcggagctacctgcatgtttttggcctctaaaatgaaggaaaccgttccattaaca
gccgagaagctttgcatatacactgacaactctattcgtccctgcgaactattgcaaatg
gaactactggcactgaacaaactgaagtgggatctagcggcagtgacgccacatgatttc
atcgagcatttccttaccaaacttccaatacatcaaagcaccaaacagattctgcgcaag
catgcccagacgtttgtggcgctctgtgcaacagacgtcaacttcatcgccaacccccct
tccatggtggcggcgggcagcgtggcggcggccgtgcaggggctgtacctgaaaagtagc
aacggctctctctcctcccagaacctcaccaacttcctctcccaggtcatcaggagtgac
ccggactgtttgcgatcgtgccaggagcagatcgagtcattgctggagttgagcctcagg
caagcacagcaacacagcatctccacagagaccaagcgcgtggaggaggacgccgacctc
tcctgcacgcccacagacgtcagggatgttaacatctga

DBGET integrated database retrieval system