KEGG   Electrophorus electricus (electric eel): 113581592Help
Entry
113581592         CDS       T05787                                 

Gene name
sln
Definition
(RefSeq) sarcolipin
  KO
K22642  sarcolipin
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eee02000]
    113581592 (sln)
Transporters [BR:eee02000]
 Other Transporters
  Pores ion channels [TC:1]
   113581592 (sln)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sarcolipin Phospholamban
Motif
Other DBs
NCBI-GeneID: 113581592
NCBI-ProteinID: XP_026872643
LinkDB All DBs
Position
Unknown
AA seq 32 aa AA seqDB search
MDRSTQELFLNFMIVLITVLLMWLLVKSYQDA
NT seq 99 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatctacgcaggagctgtttctgaactttatgatcgtattgatcacagttctg
ctcatgtggttgctcgtcaaatcctaccaggacgcgtga

DBGET integrated database retrieval system