KEGG   Electrophorus electricus (electric eel): 113581843
Entry
113581843         CDS       T05787                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04080  Neuroactive ligand-receptor interaction
eee04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113581843
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113581843
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:eee04030]
    113581843
G protein-coupled receptors [BR:eee04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    113581843
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 113581843
NCBI-ProteinID: XP_026873078
LinkDB
Position
Unknown
AA seq 349 aa
MYPRQCEGHGQNISFFYSRSNKSIIPQWKPIDFVVVGLGVPVCILIILANMLVMAAIVVN
RRFHFPIYYLLGNMAAADLFAGISYFYLIFHTGPWTIGLSQTQWLVRGALIEMSLMASVV
NLLAVAWERHQTIFTMQLHSTMSNRRVLLFIVAIWVVAVVMGLVPTMGWNCVCDLALCST
VAPLYSRSFLVFWAILNLLTFSVMVAIYARIFVYVRRNSRSVAPHAAHNGHNDTVVGLMK
TVSMILGTFVICWTPGLVILLLDGLECKQCEVLKYEKYCLVLAECNSLVNPIIYSCRDEE
MRDTFRRLLCLFCSRKEEQEQENTDTQGDALNKVRLLSENSNHTDRLTL
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtaccctagacagtgcgaaggacatgggcaaaacatctcattcttctactctcggagt
aacaagtccatcatcccgcagtggaagccgatcgactttgtggtggtgggactcggggtc
ccagtctgcatcctgatcattctcgccaacatgttggtcatggctgccatagtcgtcaac
cggcgcttccacttccccatctactacttgctgggcaacatggccgcggctgacctgttc
gccggcatttcctacttctacctcatcttccacacgggcccgtggactatcgggctgtcg
cagacccagtggctcgtgcgcggggccctcatcgagatgagcctgatggcctcagtggtc
aacctgctggccgtggcgtgggagcgccaccagaccatcttcactatgcagctgcacagc
accatgtcaaaccggcgcgtgctgctcttcatcgtggccatctgggtggtggctgtggtt
atgggcctggtgcccaccatgggctggaactgcgtgtgcgacctggctttgtgctccacg
gtagcgccgctgtactcccgcagcttcctggtcttctgggccatcctcaacctcctcacc
ttctccgtgatggtggccatctatgcacgcatcttcgtctacgtccggcgcaacagccgg
agcgtcgccccgcacgccgctcacaatggccacaacgacacagtcgttggcctgatgaaa
acggtctccatgattctgggcacctttgtgatctgctggactcccggtctggtcattctt
ttgctggacgggctggaatgtaagcagtgtgaggtcctgaaatacgagaagtactgcttg
gtactggccgagtgcaactccctggtgaaccccatcatctactcctgtcgggacgaggag
atgagagacaccttccgacgcctcctctgtctcttctgcagtcgcaaggaggagcaggag
caggagaacaccgacacgcagggtgatgctctgaataaagtgcgcctgctgtcggagaac
tccaaccacacggatcgcttaactctgtga

DBGET integrated database retrieval system