KEGG   Electrophorus electricus (electric eel): 113582065Help
Entry
113582065         CDS       T05787                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega-1 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00480  Glutathione metabolism
eee00980  Metabolism of xenobiotics by cytochrome P450
eee00982  Drug metabolism - cytochrome P450
eee00983  Drug metabolism - other enzymes
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113582065 (gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113582065 (gsto1)
   00982 Drug metabolism - cytochrome P450
    113582065 (gsto1)
   00983 Drug metabolism - other enzymes
    113582065 (gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eee02000]
    113582065 (gsto1)
Enzymes [BR:eee01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     113582065 (gsto1)
Transporters [BR:eee02000]
 Other Transporters
  Pores ion channels [TC:1]
   113582065 (gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin CitX
Motif
Other DBs
NCBI-GeneID: 113582065
NCBI-ProteinID: XP_026873429
LinkDB All DBs
Position
Unknown
AA seq 240 aa AA seqDB search
MASTQKCYGKGTCVPGPVPNGQIRIYSMRFCPFAQRTRLVLSAKGVKHETVNINLKDKPE
WFLAKNPLGLVPTLETPFGQVIYESPITCEYLDEVYPEKKLFPSDPFEKAQQKMLLEEYS
KVIPLFYKIPGSRKNGEDVSALEAEFKEKLSKLNEVLVKKKTSFFGGNSVTMIDYLIWPW
FERLEAWQLNHCLDGFLELKKWVSCMLEDPAVKDIIHNTDTHKAFFNSYLDGNPNYDYGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgactcaaaagtgctatggcaaaggaacatgtgttcccggcccagttcccaat
ggtcaaatacggatctacagcatgagattctgcccctttgcccagagaacaaggctggta
cttagtgccaagggtgttaagcatgaaactgtgaacatcaatttgaaggacaaacctgaa
tggttcctggcgaagaaccctcttggcctagtgccgaccctggagaccccctttggtcag
gtgatctatgaatcaccaatcacatgtgaatacctggatgaagtatatccagagaaaaaa
ctgtttccctcagacccctttgaaaaagctcaacagaagatgttgctagaggagtactca
aaggtcattccattgttctacaagatccctggaagcaggaaaaatggtgaggatgtgtct
gcactggaagcagagtttaaggagaagctctccaagctgaatgaggtgcttgttaagaag
aaaaccagtttttttggaggcaactcggtcactatgattgattacctgatttggccttgg
tttgagaggttggaggcgtggcagctgaatcactgtctggatggctttctggagctgaaa
aagtgggtttcatgcatgctagaggatccagcagtaaaggacattatccacaacacggat
acccacaaagcctttttcaactcatacctggatggaaatcctaattatgactatggttta
tag

DBGET integrated database retrieval system