KEGG   Electrophorus electricus (electric eel): 113583134
Entry
113583134         CDS       T05787                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00230  Purine metabolism
eee01100  Metabolic pathways
eee04020  Calcium signaling pathway
eee04114  Oocyte meiosis
eee04261  Adrenergic signaling in cardiomyocytes
eee04270  Vascular smooth muscle contraction
eee04371  Apelin signaling pathway
eee04540  Gap junction
eee04912  GnRH signaling pathway
eee04914  Progesterone-mediated oocyte maturation
eee04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113583134 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    113583134 (adcy3)
   04020 Calcium signaling pathway
    113583134 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113583134 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113583134 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113583134 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    113583134 (adcy3)
   04916 Melanogenesis
    113583134 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113583134 (adcy3)
   04270 Vascular smooth muscle contraction
    113583134 (adcy3)
Enzymes [BR:eee01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     113583134 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Calmodulin_bind OPA3
Other DBs
NCBI-GeneID: 113583134
NCBI-ProteinID: XP_026875083
LinkDB
Position
Unknown
AA seq 1119 aa
MHRNRAFSEPECSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIVMCAVVYTSDKLASVAVASVGLAADVL
LYLLCRYGLLPERISRRLVPYALWVLIEAQIFCYLGLNFARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITAVSCGVHTLVLGVTIAQQQQEDIQGAALGRQLLANMLIYLCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEAS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYRDDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISHSTLECLHGEFDVEPGNGGDRCE
YLKERGIETYLVVVPKGPVSKNAINGVKLSMTSSNGSSPLLINTTECNGSVHTGCTTPEE
LEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKS
TNRLSLRFVDPELEIRFSVEKEKQSGAAFSCSCVVLLFTAVIEVLIDPRMIANYVTLAVG
EVLLLILTICSLAAIFPRVFPKRLVSFSTWIDHTRWARNTWAMAAIFILTLADIIDMLSC
QAAPPLEPNPEDVSPASAGEGGCVENPKYYSYISVLALIATTMLVQVSHMVKLTLMLLIT
LATGVVNIYSWRDIFDQYDLARYKDYRAYLVPSKYSVTVMIFIMMVSFYYFARHVEKLAR
TLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVM
FASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDESQFRFITKIKTIGSTYMAAS
GVTPDISTNGYVCVKKEELSDRERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGLN
KGAVLAGVIGARKPHFDIWGNTVNVASRMESTGVMGNIQVVEDCYSILKDYGFRFVRRGP
IFVKGKGELLTYFLKGREKQGSFINGSSVTLPHQVVDSS
NT seq 3360 nt   +upstreamnt  +downstreamnt
atgcatcggaatcgggccttctctgagccagagtgctcagcagagtattcagcagactgc
tctgtcacactgccgtccgacccgggccaggcagtggggcgcacacacgaggtgactgta
cgtagctcaggctgctgtctatgtctccctcgcttcatgcgcctcacatttgctccagag
tcgctggagaacctctatcagacatacttccgccggcagcggcacgagaccctgctggtg
ctggtggtgttcgctgccctcttcgactgctatgtgatcgtcatgtgcgctgtggtctac
accagcgacaagctggcctctgtggccgtggcgtctgtaggcctcgctgctgacgtcttg
ctatacctgctgtgccgctatggcttgctgccggagcgcatctcccggaggctggtgccc
tatgccctgtgggtactcatagaagcccagatcttctgctacctgggactgaactttgcc
cgcttccaccaggccagcgacacggtgggatggcaggccttcttcagtttctccttcttc
ttgacgttgccgctgcgacttacccccatcgtgctcatcacggctgtgtcctgtggggtg
cacaccctggtgctgggggtcaccatcgctcagcagcagcaggaagacatccagggagct
gctctcgggagacagctcctggccaacatgctgatctacctatgtgccatcacagtgggg
gtcatgtcatattacatggctgaccgcaaacaccgcaaggcctttctggaggccaggcaa
tccctggaagtcaagctgaatctagaggaacagagtcagcagcaggagcgcctcctgctg
tccattctgcccaagcatatagccgatgagatgttgcaggacatgaagaaggaggccagt
cagaaggagatgcaacagttcaacaccatgtacatgtatcgccatgagaatgtcagtatt
ctgtttgcagacattgtgggcttcacccagctctcctcgtcctgcagtgcgcaggagctg
gtcaagctgctcaacgagctgtttgcccgctttgataagctggctgctaaataccaccag
ctgaggataaagattcttggggactgctactactgtatctgtggccttccagattaccga
gatgaccatgcagcctgctccatcatgatgggcttggccatggtggaagctatttcctat
gttcgagaaaagacccagacagatgtggacatgcgtgtgggagtgcattctgggaccgtt
ctggggggagtgctgggacagaagcgctggcagtatgatgtgtggtccacagatgtgact
gtagctaacaaaatggaggctgggggcatacctgggagagtgcacatttcccacagcact
ctggagtgccttcatggtgaatttgatgtggagccggggaacggaggtgaccgctgtgaa
tacctgaaggagaggggcattgagacgtatttggtcgttgttccaaagggccctgtaagc
aaaaatgccatcaatggagtaaagctctcaatgacttcatccaatgggagctcgccactg
ttgatcaacacaacagagtgcaacggcagtgtgcacacaggctgcaccacgcccgaggaa
ctcgaggagctggacacccgggtggtgaacccctcatttccaaatcctcggcggcggctg
cgattacgagacctagccgagagggtgattgacgctcaggaaaatgaacaggagctgaat
aaactcctaaacgaggctctgttggagagagagacagtgcaggcattaaagggaaagtcc
acgaaccgactgtctctgcgctttgtggacccagagctggagatacgcttctcagtggag
aaggagaaacagagtggagctgctttcagctgctcctgtgtggtgttgctcttcactgca
gtcatcgaggtacttatagacccacggatgatagctaactatgtgactcttgctgtgggg
gaagtcttgctgctcattctcaccatctgctccctggcggccattttcccacgggtgttt
cctaaaagactggtgtcgttctctacatggattgatcacacacgctgggctcgcaacact
tgggccatggccgccattttcatccttacattggcagacataatagacatgctaagctgt
caggcagctccacccctcgagccaaacccagaggacgtttctccagcctcggctggggag
gggggttgcgtggagaaccctaagtactacagctatatttccgtgttagcgctaatagcc
actaccatgctggtgcaggtcagccacatggtcaagctcacccttatgctgttgatcacg
ctggccacaggcgtggttaacatctacagctggagagacatctttgaccagtacgatcta
gcccgctataaagattacagagcatatctcgtgccctccaaatattctgtgactgtgatg
atcttcattatgatggtcagcttctactacttcgcccgacatgtggaaaaactggcccgc
acactcttcctgtggaaaatcgaggttcatgagcagaaagaaaaagtgtatgagatgaga
cgctggaatgaggccctggtcaccaacatgctcccagagcatgttgcacgccacttcctg
ggctccaaaaagagggatgaagagctatacagtcagtcatatgatgaaattggagtcatg
ttcgcctctattcctaatttctctgacttctacacggaggagagcatcaacaatgggggc
attgagtgcttgaggttccttaatgaaattatctctgactttgatagtctcctggatgaa
tctcagtttcgttttatcaccaagattaagaccattggcagcacgtacatggcagcatca
ggagttactcctgacattagcactaatggctatgtttgcgtgaaaaaggaagaattgtct
gatagggagcgctggcagcacctggcagatctggcggattttgctctggccatgaaagtt
actcttatgaacatcaattaccagtcttttaacaacttcatgcttcgcattggcttgaac
aaaggggcagttctggctggagtcataggggctcgaaagcctcattttgacatctggggc
aacactgtaaatgtggccagtcgcatggagtctacaggggtgatgggaaatatacaggtg
gtggaagattgctacagcatcctaaaagactatggcttccgttttgtaaggaggggacca
atttttgtgaagggcaaaggagaattgctcacttatttcctgaaaggacgggaaaaacag
ggttccttcatcaatggctcctctgttacactgcctcaccaggtggtggacagttcttga

DBGET integrated database retrieval system