KEGG   Electrophorus electricus (electric eel): 113583341
Entry
113583341         CDS       T05787                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04010  MAPK signaling pathway
eee04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113583341 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    113583341 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:eee04052]
    113583341 (kitlg)
Cytokines and growth factors [BR:eee04052]
 Growth factors
  Growth factors (RTK binding)
   113583341 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 113583341
NCBI-ProteinID: XP_026875428
LinkDB
Position
Unknown
AA seq 278 aa
MKKSNIWIHTCVHLLLYITVAAYSSKIGNPITDDIKKISLLKQNIPKDYNITVRYLPKEV
SGMCWVKLNIFHLEKSLDLLANKFGNISSNKDNIGTLVQMLREMRYYIGDDLEDDMFNFE
CHYRKVEWLTGRYFKFVEDFFNTANSSQEDGECDPPPCPTTIKTTPTISVSTQHHSKVSS
EWNSTAKEGETLPKVESGTRTRNQIFLPDTLERGLLALLFIPLIAVGFLLIWKVKSRRTP
SPLQRDMDGPPLFIGVEASAPPLDDEMSEKNRLNIRAV
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaatatttggatacatacctgtgtccatttattgctttacatcacagtt
gctgcctattccagtaaaattggaaaccccataacagatgacatcaagaaaatttcgttg
ctgaagcagaatataccaaaagattacaacattactgtacgttatttaccaaaagaagtg
agtggtatgtgttgggtgaagctaaatatattccacttggagaagagcttagatctcctg
gccaataagtttgggaacatttcctccaacaaagataatatagggaccttagtccaaatg
ttgcgtgagatgcgatattacattggagatgacttggaggatgacatgtttaattttgag
tgccactacagaaaagtggagtggctgacagggcgctacttcaagtttgtggaagacttt
ttcaacactgccaattcttcacaggaagatggggagtgtgaccctccaccatgtcccacc
acaataaaaacaacaccaacaatatcagtgtcaacacagcatcattcaaaagttagttct
gaatggaacagtactgcaaaggaaggtgagacattacctaaagttgaaagtggaactcga
accaggaatcagatattccttccagacactttggagaggggtctgctcgcacttctcttc
atacctctcatcgctgtgggcttccttctaatctggaaggtgaaatccagaagaactccc
tccccgttgcagagggatatggatggcccaccactgtttattggagtggaggccagtgct
ccaccattagacgatgaaatgtctgaaaagaacagattaaacatcagggcagtgtaa

DBGET integrated database retrieval system