KEGG   Electrophorus electricus (electric eel): 113583571
Entry
113583571         CDS       T05787                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04012  ErbB signaling pathway
eee04068  FoxO signaling pathway
eee04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113583571
   04068 FoxO signaling pathway
    113583571
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113583571
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113583571
NCBI-ProteinID: XP_026875766
LinkDB
Position
Unknown
AA seq 191 aa
MSNVHLSSGSPTLERMDARLSDQPKPSACRCLFGPVDHEELKKELKGHLKAMEEASSETW
DFDFSSHTPRSNGRYRWKAVDSKDLPSFYSASERQGKQICSTGNNSVDVNGNHDRVVVTP
CRLVEDKTERSESQLEKMDQHVKGQRKRPSCLDSSCQAKRSHTCLDEVSRRPGLTQTVDY
TPKKSSPPTQT
NT seq 576 nt   +upstreamnt  +downstreamnt
atgtctaacgtacatctttcaagtgggagcccaactcttgaaaggatggacgctaggttg
tccgaccagccgaaaccctccgcctgcagatgtcttttcgggccagtggatcacgaagag
ttaaagaaggaattaaagggacacttgaaagcgatggaagaggcgtcgtcggagacgtgg
gacttcgacttttcaagccacactcctcgctcgaacgggagataccgctggaaggcagtg
gatagtaaggacttgccgagcttctacagcgcctctgaacggcagggcaaacagatctgc
tcgactgggaataacagtgtggatgtaaatgggaaccatgatcgtgtggtggtgactccc
tgtcggctagttgaggacaaaacggagcggtctgaaagtcaactggaaaaaatggatcag
catgttaaggggcagagaaaaagaccgtcgtgtcttgactcatcatgtcaagcgaaacgg
tcgcacacctgtctagatgaagtttctcgtcggccgggtttgacacagacggtagattac
acacccaagaaatccagccccccgacacagacgtaa

DBGET integrated database retrieval system