KEGG   Electrophorus electricus (electric eel): 113583804
Entry
113583804         CDS       T05787                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
eee  Electrophorus electricus (electric eel)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2 Ras_bdg_2 CaiF_GrlA
Other DBs
NCBI-GeneID: 113583804
NCBI-ProteinID: XP_026876162
LinkDB
Position
Unknown
AA seq 352 aa
MIEFIELKDLTPNDRIELAPPAVPTAARQLPMDKVPERPRRGVVVRLDEADWVAGRHGAG
HVFQPSSHAHLTWCDLCGEFIWGLYKQNLRCVNCRYTCHSRCQPFIKLDCISLNTLPGLS
DYSENTETDTNVDDPIDWQKLDVPLSEIQRKIKQYNAQVNSNLYMTLNQDGSYTGFIKVQ
FKLARPVSVPLLRRPTSSSPQHGGWRAAVNHRTSFYLPRDTAEHLHVSSRTRAREVIEAL
LNKFRVVDRPAKFALFEHSMRRDQVYLRKLSDDECPLLLRLCAGPSEKALGFVLKENELG
EVNWDAFSLPELRNFLRILQREEEEHMQQITRRYSVARHRLAEALQNFSTPG
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgattgagttcattgaactgaaggacctgacgcctaatgataggattgagctagcgccc
cctgctgtgcccactgcagcacgacagctgccgatggacaaggttccggagaggccaagg
cgaggtgtggtggtgcgcctggacgaggcggactgggtcgcaggcagacatggagcggga
catgtcttccagcccagcagccacgcccacctcacttggtgtgacctttgtggggagttc
atctgggggctgtacaaacagaacctgcgctgtgtcaactgcagatacacctgccattcc
cgatgtcagccttttatcaagttggactgcatctccctgaacactttgcctggactctca
gactacagtgagaacactgagacggataccaacgtggatgatccaattgactggcagaag
ctggatgtgcccctcagtgagatccagcggaaaattaagcagtacaatgctcaagtcaac
agcaacctttacatgaccctgaaccaggacggttcgtacacaggtttcattaaggtccag
ttcaagctggctcggcctgtgtctgtgcctctcctgcgaaggcctacttcctcctcgcct
cagcacggtggctggcgagcggcggtgaatcacaggacgtcgttctacctccctcgagac
acggccgagcacctgcacgtgagctcgcgcacccgggcccgtgaggtcatcgaggcactg
ctgaacaagttcagagtagtggacaggccagccaagttcgcgttgttcgaacacagcatg
agacgcgaccaggtctacctcaggaagttatctgacgatgagtgtcccctcctgcttcgc
ctgtgtgcaggccccagtgagaaagccctgggctttgtgctaaaggagaatgagctgggg
gaggtcaactgggacgcgttcagtctacctgagctgcggaacttcctgcgcatcctacag
agggaggaggaggaacacatgcagcagatcacgcgccgctactcagtggcacggcacagg
ctggccgaggcactgcagaacttcagcacacccggctga

DBGET integrated database retrieval system