KEGG   Electrophorus electricus (electric eel): 113583832
Entry
113583832         CDS       T05787                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04141  Protein processing in endoplasmic reticulum
eee04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:eee00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113583832 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113583832 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eee03000]
    113583832 (atf6b)
Transcription factors [BR:eee03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    113583832 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA CENP-H
Other DBs
NCBI-GeneID: 113583832
NCBI-ProteinID: XP_026876209
LinkDB
Position
Unknown
AA seq 693 aa
MTAELLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEEGDFNRGLKYDTSLDNHLVLTL
DPDNPTSPWKHLEDHLLTGDTAVIKDDLTITQPLPVDMLFQVKAEPPSPSSSPSSDSSLS
LPEPQVSVKGENPPTPPYMYGDVLSPPLGAMEVTVATAAPPQSQSPLPGPTPSQTLNSLD
SQTTVIAAAAVLKASSILSSKPLLQPRPVCVATLPVPQTTSPAKTLILQSVPVPVPTIDQ
GRTPVVLSQSVCLSSAPAIVKMEPVSPSIPHCTSPTAPPATKPIIPASSLPGNSCGDIDM
KVLKRQQRMIKNRESACQSRRKKKEYLQNLETQLREAQQENERLRRENQALRLRLAGKEA
GDSGNNKRAVCVMVVLLFITFSFAPVSITDMKFTSPLQDEAVIHTGRHLLEQAEELPSAA
ATQRVMDSEEEGGEERWRKSDVERENADLFHFRNASSVFSGVKDLVLQDIDRLFSSSDCR
QFNRSESLRLADELRGWVHRHQIDRKKSGGKPKSLQKAKITQQKAQHRKTNFSRYLPIAA
HRSIESQLQLLSGPEVSYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTTRPKMSLV
MPAMTVNESVYNSSQGGYELMMQVDCEVMDTRIIPIKASAVPPSLRDPPPTPPSHHHHSN
QTRQHHGNGASSRQPLPIRRRGAEYLISQAGSL
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgaccgcggagctgctgtcggacctggacagtcgcttcttcgccgacaaccttctcacg
agcgaggactgggatgcgtgtctgtatcagtgtgagagtatggaagagggtgaagagggg
gacttcaacagaggactgaaatatgacacatcgcttgacaatcaccttgtcctgaccctt
gaccctgacaaccccacgtcaccatggaaacacctggaagaccatctccttactggtgac
acggccgtcataaaagacgacctgacgataacgcagcccctccctgtggacatgttgttc
caggtgaaggctgagcctccatctccttcctcctctccatcctcagacagttcactgtcc
ttacctgaaccccaggtgtcagtgaagggggaaaacccccctactccaccctatatgtat
ggagatgtcctttcccccccactgggtgccatggaggttaccgtagcaaccgctgcccct
ccccagtcccaatctccacttcctggtcctacgccaagccagacgctcaacagcctggac
agtcagaccacagtgatcgccgccgcggctgttctgaaggcgagctccatcctaagttcc
aagccactgctccagccgcggccagtttgtgtggccacattgcctgtgccacaaaccacg
agtcccgccaagaccctgatcctgcagagcgtcccagtgcccgtgcccaccatcgaccag
ggcaggacccccgtggtgctgtctcagtccgtgtgtctgagttctgctccggccattgtg
aagatggaacccgtatctcccagcatcccccactgcaccagcccgacggccccgcccgcc
accaaacccatcatccctgcatcctctctgcctggcaacagctgcggtgacatcgacatg
aaggtgctgaagcgtcaacagcggatgataaagaacagggagtcggcgtgtcagagccgc
cggaagaagaaggagtatctgcagaacctggagacacagctgcgcgaggcccagcaagag
aatgaacgactgcgcagagagaaccaggccctccgcctccgtctggctgggaaggaggct
ggagactcaggcaacaataagagagcggtgtgtgtgatggtggttctgctcttcatcacc
ttcagttttgcccccgtcagcatcacagacatgaagttcacctctccgctccaggacgag
gcagtcattcacactggcaggcacctgctggagcaagccgaagagcttcccagcgccgcg
gccacccagcgagtcatggacagtgaggaggagggaggagaggagaggtggaggaagagt
gatgtggagagggagaacgccgacctgtttcacttcaggaatgcgagcagtgtgttcagt
ggtgtgaaagacttggtcctgcaggacatcgatcgtctcttctcctcctctgactgcaga
cagttcaaccgctccgagtctctcaggttggctgatgagctgcgtggttgggtgcatcgg
catcaaattgacaggaagaagtctggtgggaaaccaaagagtttgcagaaggcaaaaata
actcagcagaaagcccagcacaggaaaaccaacttctccaggtacctgcccatcgctgct
caccgctccattgagagtcagctgcagttgctgtctgggccggaggtgagctacagcgac
ttcctggatgccattgaccgtcgtgaggacactttctacgtggtgtccttcagacgggat
cacctgcttcttcctgctataagtcataataaaactactcgacctaagatgtctctcgtc
atgcctgctatgaccgtcaacgagtctgtgtataactcctctcagggtgggtatgagctc
atgatgcaggtggattgtgaagtgatggataccaggataatccccatcaaggcttctgct
gtgccaccttccctcagagacccacccccaaccccaccctcacaccaccaccacagcaac
caaacgcgtcagcaccacggcaatggggcctcgtcaaggcaaccattacccatcagaagg
aggggggcagaatatctgataagccaagcggggtcactgtga

DBGET integrated database retrieval system