KEGG   Electrophorus electricus (electric eel): 113584194
Entry
113584194         CDS       T05787                                 

Definition
(RefSeq) putative transcription factor p65 homolog isoform X1
  KO
K04735  transcription factor p65
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04010  MAPK signaling pathway
eee04137  Mitophagy - animal
eee04210  Apoptosis
eee04218  Cellular senescence
eee04620  Toll-like receptor signaling pathway
eee04621  NOD-like receptor signaling pathway
eee04622  RIG-I-like receptor signaling pathway
eee04623  Cytosolic DNA-sensing pathway
eee04625  C-type lectin receptor signaling pathway
eee04920  Adipocytokine signaling pathway
eee05132  Salmonella infection
eee05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113584194
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113584194
  09143 Cell growth and death
   04210 Apoptosis
    113584194
   04218 Cellular senescence
    113584194
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113584194
   04621 NOD-like receptor signaling pathway
    113584194
   04622 RIG-I-like receptor signaling pathway
    113584194
   04623 Cytosolic DNA-sensing pathway
    113584194
   04625 C-type lectin receptor signaling pathway
    113584194
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113584194
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113584194
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113584194
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eee03000]
    113584194
Transcription factors [BR:eee03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    113584194
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 113584194
NCBI-ProteinID: XP_026876765
LinkDB
Position
Unknown
AA seq 619 aa
MDDLGMYGSWVQPTMPQGTPYMEIIEQPKARGMRFRYKCEGRSAGSIPGEKSNDSTKTHP
AIKVHNYSGPIRVRISLVTKNQPYKPHPHELVGKDCKHGYYEADLPERRVHSFQNLGIQC
VKKKDVTEAVSCRLQTQNNPFNIAEAKVWEEEYDLNAVRLCFQATITLPSGDLYVLEPIV
SQPIYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFRDSWEGKGSF
SQADVHRQVAIVFRTPAYCDTNLTEPVRVRMQLRRPSDREVSEPVDFQYLPSDPDEYRLM
EKRKRTEGMLQNLKLSNVISTPMSIERRTISTARRTIPGPKSSTSAGATPVLNPVSSVSS
LKTQPFFSTTPSGHLFTQPKVEPLAAVPSAGDTWPFLNSVTVQPAVTATAAPLPASQDFH
TVNLSDLRDFAFNTSFTSSAPEKTDVGPRRDGTGTAVAQDVQNNFSAPSMGNFRVDPSVD
EELPEFPSFSDAQTSDVENIDIEAFQVLLGQSGLPGEAASGNSTSVCHTIATASTSDTAG
SGTESAVSNAGNSTATWMNFPPSIANLLQSDQIVDSPVPMPSISVTFDDMDVLSSMDEDR
LMSIFNSGTQVSFLSGHPT
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggatgatttaggaatgtatgggagctgggtacagcccactatgccccaaggcaccccg
tacatggagataatcgagcagcccaaggcaagaggaatgcgcttccgctataaatgtgag
ggcaggtcagcaggtagcatcccgggagagaagagcaacgattccaccaaaacgcatcct
gctatcaaggtccataactacagtggtcccataagagtgcggatctctttggttaccaaa
aaccaaccctacaagccccacccccatgagctggttggtaaagactgtaagcacggctac
tatgaggctgaccttcccgagagacgagttcacagttttcagaatcttggtattcagtgt
gtgaaaaagaaagatgtgactgaagccgtttcctgccgtctgcagacacagaacaaccct
ttcaatattgccgaggccaaagtgtgggaggaagagtatgacctgaatgcggtccgcctg
tgtttccaggcaaccatcactctgcctagtggggacctctatgttttggagcctatagtt
tctcagcctatctatgacaatagagcccctaatacagctgagttaaagatctgtcgcgtg
aacaggaactctggtagctgtagaggaggagatgaaatctttctactctgtgacaaagtg
cagaaagaggacattgaggtgcgctttttccgagactcttgggagggcaagggctcattc
tcacaggcagatgtccacagacaggtggccatcgtgttccgcacgccagcctactgcgac
accaacctgaccgaacccgtccgtgtcagaatgcagctgcgccggccgtcggaccgggaa
gtcagcgagcccgtggacttccagtacttgccctctgacccagatgagtacaggctgatg
gagaaacggaagcggacagagggcatgctgcagaaccttaaactgagcaacgtcatatca
actcccatgtctattgagagaaggacaatcagcactgccagaaggacaatcccaggtcca
aagtcctccacttctgcaggtgctacgccagtgttgaatcctgtgtcatccgtttcttca
ttgaagactcagccctttttcagtaccactccttcaggacatctgttcactcagcctaaa
gtggaaccgctggcagcagtgccctctgctggagacacatggccgttcctcaacagtgtg
acggtgcagcctgcagtcaccgccactgctgctccgcttcccgcttcccaagacttccac
actgtaaatctgtccgatctccgcgactttgccttcaacacgtccttcacgtcttctgct
ccggagaagactgacgtgggcccccgaagagatggcactgggactgccgtagcccaagat
gtccaaaacaattttagtgccccaagcatggggaatttccgagtggatccctcggtggat
gaagagcttccggagttcccgagcttttccgacgctcagacttcggacgtggagaatatt
gacatcgaagctttccaggtgcttctgggccagagcggacttcccggagaggctgcatct
gggaactccacttccgtgtgccataccatcgccacggccagcacttccgacaccgcgggc
agcggcacagagtcggcagtcagtaacgcagggaacagcacagcaacctggatgaatttc
cctccgagcatcgccaacctgctgcagagtgaccagattgtggacagccctgtgcccatg
ccctccatcagtgtcacctttgacgacatggacgtgctgagctctatggatgaagatcgt
ctcatgtccatcttcaacagtggcacccaagtcagcttcctgtctgggcatcctacttag

DBGET integrated database retrieval system