KEGG   Electrophorus electricus (electric eel): 113584395
Entry
113584395         CDS       T05787                                 

Definition
(RefSeq) uncharacterized protein LOC113584395
  KO
K05461  KIT ligand
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04010  MAPK signaling pathway
eee04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113584395
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    113584395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:eee04052]
    113584395
Cytokines and growth factors [BR:eee04052]
 Growth factors
  Growth factors (RTK binding)
   113584395
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 113584395
NCBI-ProteinID: XP_026877069
LinkDB
Position
Unknown
AA seq 239 aa
MFMFHMKEAKVGGCACVLVLLFSGLVTCSGVLGSPLTDDVATLKTLRENIPDDYEIPVHY
ISKDVGGACWLLLNLYPVESSLKTLALRFGNLSSNRENITIFITMLQGLRITVDSEELDA
AMQVFKCHYQSGKWSTRRYFDHVEEVLKASTSTPHQFHCTPPPCDITPAPPRTPGQGKQK
RLIDSAIPSLLALLIIPCVATLALALQAVKISLPVSSTSPQFLNLADALSKNKLCRKET
NT seq 720 nt   +upstreamnt  +downstreamnt
atgttcatgttccacatgaaggaggctaaggttgggggatgtgcatgtgtcttggttttg
ctgttttctggacttgtaacctgttctggtgtgcttgggagccctctgacagatgatgtg
gccacgttgaaaacactgagagaaaacattccagatgattatgaaattcctgtacattac
atttccaaagatgtgggtggggcttgctggcttcttctgaacctgtaccctgtagagagc
agtttaaagacgttagccctcaggtttggcaacctctcctccaacagagaaaacatcacc
atcttcatcaccatgctgcagggactacgcatcaccgttgacagcgaagagctggatgca
gcgatgcaggtctttaagtgccattaccagagtggcaagtggtccaccagacgctatttc
gaccacgtggaagaggtcctcaaagcgtccacctccactcctcaccaatttcactgcacc
cctccaccctgtgatatcacgccagccccacccagaacaccaggacagggcaagcagaaa
cgtttgattgacagtgcgatccccagcctcctggcgctgctcatcatcccctgtgttgcc
acactggcgcttgccctccaagcagttaagatctctctccccgtctcatccactagccca
caattcctcaatcttgcagatgctctgtcgaagaacaagctctgcaggaaggagacatga

DBGET integrated database retrieval system