KEGG   Electrophorus electricus (electric eel): 113585469Help
Entry
113585469         CDS       T05787                                 

Gene name
mcu
Definition
(RefSeq) calcium uniporter protein, mitochondrial
  KO
K20858  calcium uniporter protein, mitochondrial
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04020  Calcium signaling pathway
eee04218  Cellular senescence
eee04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    113585469 (mcu)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    113585469 (mcu)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113585469 (mcu)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:eee03029]
    113585469 (mcu)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eee02000]
    113585469 (mcu)
Mitochondrial biogenesis [BR:eee03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    113585469 (mcu)
Transporters [BR:eee02000]
 Other Transporters
  Pores ion channels [TC:1]
   113585469 (mcu)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCU
Motif
Other DBs
NCBI-GeneID: 113585469
NCBI-ProteinID: XP_026878776
LinkDB All DBs
Position
Unknown
AA seq 374 aa AA seqDB search
MAVKVCRLLLSRSSVAVVSPFPVLGVPSHRHHQRTRTEVLSGPFAHQSVRRGHSLRSAGR
AALFSQPSASLPPQGWLGTPTWPAQRLLCSPAASEEVTVVYQNGLPVISARLPSRRERCQ
FTLKPLSDSVGIFLQQLQTEDRGIDRVAIYSTNGERIASSTGIDILLLDDFKLVINDTTH
LVRPPRRELMPHEEAERLNDVKFLVQQLYTTLHIEEHQLTKERELISRLEDLNSQLRPLE
KVKEELSRKAERRTTWVLWGGMAYMATQFGVLARLTWWEYSWDIMEPVTYFITYGTAMAM
YAYFVLTRQEYIYPDARDRQYLLFFHKGVKRTRFDIERYNQLKDAIAEAELDLKRLRDPL
QLHLPVQQINSSKD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgaaagtgtgcagactcttgctgtcccggagcagcgttgcagtagtttccccc
ttccccgtgctcggtgtcccttcacatcggcatcatcaacgcacaagaacggaggtgctg
tcggggccatttgcccaccagagtgtgagaagaggacattccctgcggtctgctggcagg
gcagcactcttcagccagcctagcgcctcactacctccccagggttggttgggaaccccc
acatggcctgctcagagactgctgtgctcacctgcagcttcagaagaggtgactgtggtg
tatcagaacggtctgccggtaatctctgcgaggctgccgtcacggcgggagcggtgccag
ttcactctgaagcccctcagtgacagtgtgggcatcttcttacagcagctacagactgag
gaccggggcatcgaccgagtcgccatctactctacaaatggagagaggatagcctcctcc
acggggatcgacattctactgctggatgactttaagctggtcataaatgacactacgcat
ctggtgcgtccgcccagaagagagctgatgccacacgaggaagctgagcggctgaacgac
gtcaagttcctggtgcagcagctctacaccaccctgcacatagaggagcaccaactcacc
aaagagagagagctcattagtcgactggaggacctcaactcccagctccgcccactggaa
aaggtgaaggaggagctaagcagaaaggcggagcgcaggaccacatgggtgctgtggggg
ggcatggcctacatggccactcagttcggcgtgctggcgcgcctcacctggtgggagtac
tcgtgggatatcatggagcccgtcacctacttcatcacctacggcacagccatggccatg
tatgcctactttgtgctcacgcgccaggagtacatctaccccgatgccagagacagacag
tacttgctgtttttccacaagggggtgaagaggacacgctttgacatcgaaaggtataac
caactgaaggacgctattgctgaggcggagttggacctgaaacgtctgagagatcctctc
caactgcacctccccgtccagcaaatcaacagcagcaaagactga

DBGET integrated database retrieval system