KEGG   Electrophorus electricus (electric eel): 113586382
Entry
113586382         CDS       T05787                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04010  MAPK signaling pathway
eee04020  Calcium signaling pathway
eee04144  Endocytosis
eee04510  Focal adhesion
eee04540  Gap junction
eee04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113586382 (pdgfra)
   04020 Calcium signaling pathway
    113586382 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113586382 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113586382 (pdgfra)
   04540 Gap junction
    113586382 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113586382 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eee01001]
    113586382 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:eee04090]
    113586382 (pdgfra)
Enzymes [BR:eee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     113586382 (pdgfra)
Protein kinases [BR:eee01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   113586382 (pdgfra)
CD molecules [BR:eee04090]
 Proteins
  113586382 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set Herpes_gE Kinase-like SKG6
Other DBs
NCBI-GeneID: 113586382
NCBI-ProteinID: XP_026880253
LinkDB
Position
Unknown
AA seq 1464 aa
METVQTHLLLGAVLVSMLSEVWRVACALPPPTIVSNQEEFVLEPHSGFNVSCTGKKNVVW
EEPLPSNAHVLPGFYTATLLINDAAVHHTGHYTCVYESTGGVRDDNDNNSASIYIFVPDP
QVPFVPEDPKSAHPLSIPCRVTDPLASVVLRSLPRGDELSALYDNKHGFLGMFAPGRYVC
ETVVGGRTVRSVEYTVDEEPDMYEAMDFSVELKASHKEVKEGEPFNITCEVPAGAPYLQQ
WVHLSKQAVGAVQMKQTFPDKVLYVLSIPQASLADSGFYECSVTEQHSGTTRTSHVTVSV
HQSSVVVLDPSGIGPLETATLLQETEFTIYIHSNIPPKVTWFKDDHALEGPLVTTRTTLL
DDKRYESVLVLSHPAEDDCGTYKIVAQAGSHTAEFSFMLHVQATDLLLAHSLRAPVIWPN
LDTMVVSLHSTFRLICHGQAELMWDSPVVLDKQMLSHKQGLYISTMTVDNATAAHTGEYI
CEYHHRNQTDESSIYVYVPDPDMPFVPPVIPFANHVLTNLDEMEVPCRVSDPSTNVTLVH
VEAGQVVPALYDSRRGFLGLFTAGTYVCRTLIGGQVHDSEEYIVHGWTGGSGLRVELNTD
RKALLLGETLTVSCVAKGSEMLEDHWKYPGKLAGRGTKTVKENKRDEEILYTLTVSNATT
KDSGVYTCSITDIMSSETQTKELSITVYEMEFVSVVPMFVAMETAKLDDVREFCVDIEAL
PAPEVTWLKDGIVLGDVSAEIATSTRAISETRYQSILTLIRAKAEDSGNYTVRAELGNLS
VSHSFTLQVKVPPAIVDLMDLHHGSATGQAVVCIAGGSPIPEVEWYICTNIKHCANDSTQ
WSPLQTNTTGVTVDTHVDQNKQLESQVIFGHLENTLAVRCLARNDMAAVTREIKLVSTGP
HSELTVAAAVLVLLVIVIISLIVLLIIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLP
YDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQQVMKVAVKMLKPTARSSEKQAL
MSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDGFLSRHPEKT
KKDLDIFGINPADENSRSYVILSFEEKGDYMDMKQADTMQYVPMLERTNTAKYSHLHGDD
YDHPPSHKHGSEIEVEKLLSNDSEGLTTMDLLSFTYQVARGMEFLASKNCVHRDLAARNV
LLSQGRIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGIL
LWEIFSLGGTPYPGMLVDSSFYNKIKSGYRMAKPEHATNDVYELMVKCWNNEPEKRPSFW
SLSETVVSLLPSAYKRNYERVNNDFLKSDHPAVTRVQCVQNDNAYLGVAYKNQGKLRERE
SGLDEQRLSSDSGYIIPLPDLDPLSDQEYTKRNRHSSQTSEESAIETGSSSSTLPKREGE
TLEDVTLLDEMCLDSGDLVEDSFL
NT seq 4395 nt   +upstreamnt  +downstreamnt
atggagaccgtgcaaacgcatctccttctcggggctgtgctggtcagcatgctgtcagag
gtttggagagtcgcgtgcgcactccctccaccgaccatcgtttccaaccaagaagagttc
gtgctcgagccgcactccggttttaacgtcagctgcacggggaagaaaaacgtggtctgg
gaagagccgttaccgagcaatgcccacgtcctcccgggattctacaccgcgaccctgctg
ataaacgacgcggcggtccaccacacgggacactacacgtgcgtttacgagagcacgggc
ggtgtgcgcgatgacaacgataacaactctgccagtatctatattttcgtcccagatcct
caagtgccatttgtgcccgaggacccaaagagcgcgcacccattgagcattccctgtcgc
gtgacggaccccctggcaagcgtggttctccgcagcctgccgcgtggagacgagctcagc
gctctctacgacaacaagcacggcttcctcggcatgttcgcccccgggcgctacgtgtgc
gagaccgtcgtgggcggcaggacggtccggagtgtggagtacaccgtggacgaggagccg
gatatgtatgaagcgatggatttcagtgttgaactcaaagccagtcataaggaggtgaag
gaaggagaaccgttcaacatcacctgtgaggttcccgctggtgccccctacctgcagcag
tgggtgcacctcagcaagcaggctgtaggtgctgttcagatgaagcagacctttcctgat
aaggttctgtacgtacttagtatcccacaggcctctctggccgactccggcttctacgag
tgctctgtcactgagcagcacagtggcacgacccggacctcccacgtgactgtctcagtc
caccagagctccgtggtggtgctggaccccagtgggatcggaccgctggagacggccact
ctcctacaggagaccgagttcaccatctacatccattccaacattcctccaaaggtcacg
tggttcaaggatgaccatgcgctggagggccctctggtcaccaccaggaccactctgcta
gacgacaagaggtacgagagtgttttggtgctgagtcaccctgcggaagatgactgtggg
acatataagattgtagcacaggccggctcccacaccgctgagttctccttcatgctccat
gtccaagccacagatctgctgctggcccactctttgcgggctccggttatctggcccaat
ctggacaccatggtggtgtccctgcactctaccttcagacttatatgtcatggtcaggca
gaactcatgtgggacagccccgtggtcctggacaagcagatgctcagccacaagcaaggc
ctctacatctccacgatgaccgtggacaacgcaacagcagcacacacaggggagtacatc
tgtgaataccaccacaggaaccagactgatgagagcagcatctacgtctatgtcccagac
ccggacatgccattcgttcccccggtgataccttttgcgaatcacgtgctgaccaatctg
gatgagatggaggtgccgtgtcgcgtgtctgacccaagcaccaacgtcacgctggtccat
gtggaggcggggcaggtggtcccggccctctacgacagcaggaggggcttccttggcctc
ttcaccgctggcacgtacgtgtgccgcactctcatcggtggccaggtgcacgacagcgag
gagtacatcgtccacggctggactggaggttcggggctgcgtgtggagctaaacacagac
aggaaggctctgctgctgggggagaccctcaccgtgagctgtgtggccaagggcagtgag
atgctggaagaccactggaaataccccggcaaactggctggccggggaacaaagactgtg
aaggaaaataagagagacgaagagattttgtacaccctgaccgtgtccaatgccactact
aaggacagcggtgtgtacacctgctccatcacagacatcatgagcagtgagactcaaacc
aaggagcttagcatcaccgtctacgagatggagttcgtgtccgtggttcccatgtttgtc
gccatggagacggccaaactggacgatgtgcgtgagttctgcgtggacatcgaggcactt
ccagccccagaggtcacgtggctaaaggacggcatcgtcctgggcgacgtctcggcggag
atcgccacctccacacgggcgatcagcgagaccaggtaccagagcattctgactctcatc
agggctaaggctgaggacagtggtaactacaccgtgcgagctgaacttggcaacctgagc
gtcagccactccttcaccctacaggtcaaagttcctccggcgatcgtggacctgatggac
ctccaccacggctctgcgacaggccaggctgtggtgtgtattgctggaggctcccccatc
ccagaggtggagtggtacatctgcacaaacatcaaacactgtgccaatgactcgacccag
tggtcacctctgcagaccaacaccacaggggtcacagtggacacacatgtggaccagaac
aagcagctggagagtcaggtcatcttcggtcatttggagaacacgctggccgtgcgctgc
ctggcccgcaacgacatggccgccgtcacgcgggagatcaagctggtgtccaccggtcct
cactctgagctcacggtggcggctgcagttctggttctcttggtcattgtcatcatctca
ctcattgtgctgctcattatctggaaacagaagcctcgctatgagatcaggtggcgggtc
atcgagtcggtcagtccagacgggcacgaatacatttatgtggatcctatgcagcttcct
tatgactcgcgttgggagttcccacgcgatggccttgtcctgggccgtgttctgggttcg
ggggcctttggaaaggtggtggagggcaccgcatatggtctgagtcgttctcagcaagtc
atgaaggtggcagtgaagatgctcaaaccgacagcacgttccagtgagaagcaggcgctg
atgtctgagctgaaaatcatgactcatctgggcccgcacctcaacatcgtcaacctgctg
ggagcgtgcaccaaatcaggtcctatctacatcatcactgagtactgtttctatggagac
ctggtgaactacttacataagaacagagatggcttcctgagcagacacccagagaagacc
aagaaagacctggacatcttcgggatcaaccccgcagacgagaacagcaggagctatgtg
atcctgtcctttgaggagaagggtgactacatggacatgaagcaagcagacaccatgcag
tatgtccccatgctggagagaaccaacacagcaaagtactctcatctccatggagacgac
tatgaccaccctccctctcacaagcacggcagcgagattgaggtggagaagcttctctcc
aatgactctgagggtctgaccacgatggatcttcttagcttcacctatcaggtggccaga
gggatggagttcttagcctctaaaaattgcgtgcatagagacctggcagcacgtaatgtg
ttgctgtcccagggaagaattgtgaagatctgtgactttgggctggccagggacatcatg
catgacaacaattatgtatccaaaggaagtaccttcttaccggtgaagtggatggcccct
gagagcatctttgataacctctacaccaccctgagcgacgtctggtcttacggcatctta
ctgtgggagatcttctcccttggagggactccttatcccggcatgcttgtggactccagc
ttctacaataaaatcaagagtggctacaggatggccaaaccggagcatgcaaccaatgac
gtttatgagctgatggtgaagtgctggaacaacgagccagagaagaggccatccttctgg
agcctgagtgagaccgtggtctccctgctgccttccgcttacaagaggaactatgaacgc
gtgaacaatgacttcctgaagagcgaccacccggcggtaacacgggtccagtgtgtgcag
aacgacaacgcctacctgggcgtggcttataagaaccagggcaagctacgggagcgtgag
agcggattggacgagcagagactgagctctgacagtggctacatcatcccactgcccgac
ctcgacccgctctccgaccaggagtacaccaagaggaaccgccacagctcccagacgtct
gaggagagtgctatagagacagggtccagcagctccactctacccaagcgggaaggagag
acacttgaagatgtcactctgttggacgagatgtgcctggactcaggggacctggtggag
gacagcttcctgtga

DBGET integrated database retrieval system