KEGG   Electrophorus electricus (electric eel): 113586971
Entry
113586971         CDS       T05787                                 

Gene name
cdkn1a
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04012  ErbB signaling pathway
eee04068  FoxO signaling pathway
eee04110  Cell cycle
eee04115  p53 signaling pathway
eee04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113586971 (cdkn1a)
   04068 FoxO signaling pathway
    113586971 (cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113586971 (cdkn1a)
   04115 p53 signaling pathway
    113586971 (cdkn1a)
   04218 Cellular senescence
    113586971 (cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113586971
NCBI-ProteinID: XP_026881221
LinkDB
Position
Unknown
AA seq 223 aa
MLRVGFPPRLEALGVTNRLLVSEINQPGSESAWNRRSGNFGSLQQETKGRVSSQYLVTCI
HMAVHRQILESLGNGTACRNLFGPVDREQLQVEYKDALQKDIEDASRRWGFDFVLEKPLE
GGDFQWEGVSGACMPALYHACAVGDMSWQREVESTAVTTCGAEPRLGQSAGGKENVPRSP
ERHISSLEKTPEKTHMPKRKQTNITDFYQAKRRIVATPRKSGQ
NT seq 672 nt   +upstreamnt  +downstreamnt
atgttaagggttggatttccaccccgcttggaggctctgggcgtgactaaccgacttctc
gtcagcgagataaaccagcctggctctgagagcgcgtggaataggcggagtgggaatttc
ggctcattgcaacaggagacgaaaggtcgagtttccagtcagtatctggttacctgtatt
cacatggctgtgcataggcagatcctggagtctctgggtaatggtacggcctgccgtaat
ctgtttggtccagttgatcgggagcagctgcaagtggaatataaagatgcgctccagaaa
gacatagaagatgcatcacggcgttggggtttcgactttgttttggaaaagcctctggag
ggtggagacttccagtgggagggagtttctggggcttgtatgcccgctctgtaccatgca
tgcgctgtaggggatatgtcttggcagcgggaggtggagtctacagcagtcaccacctgt
ggggcagagcctcggctgggtcagtctgcaggcgggaaagagaacgttcccagaagcccg
gagaggcatatcagcagtctggagaaaacaccagagaaaacacacatgcctaagaggaag
caaaccaacatcacagacttctaccaggctaaacgacgaattgtggccactcccaggaaa
tcaggccagtga

DBGET integrated database retrieval system