KEGG   Electrophorus electricus (electric eel): 113588107
Entry
113588107         CDS       T05787                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04080  Neuroactive ligand-receptor interaction
eee04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113588107
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113588107
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:eee04030]
    113588107
G protein-coupled receptors [BR:eee04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    113588107
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 113588107
NCBI-ProteinID: XP_026882959
LinkDB
Position
Unknown
AA seq 368 aa
MASTTAAPPVCYYDSNVSFFYLNVNKTIPEEWRPQDYVVVGLGLTVCVFIILTNILVMSA
IFMNRRFHYPIYYLLGNLAAADLFAGIAYMHLMFHTGPWTKKLSIYQWFLRQGLIDTSLT
ASVINLMAIALERHQTIFTMQLHSSMTNRRVILLILAIWLIAIVMGLVPTMGWNCMCDLQ
NCSKMAPLYSRSYLVFWAVLNLFSFTVMVVVYTRIFIYVRRKNLRMSQHTSQTKHKETVV
SLMRTVFMILGCFVICWTPGLVLLLLDGVNCGCGVLTYEKYMLVLAEFNSLMNPIIYSYR
DQDMRRTFKRILCCLWPRAGGRGQHAGVRFNTLEQETIRLQSGVPPQQPKGPQLVLRNAE
DLHHSVHI
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggcgtcaacgacagctgccccaccagtttgctattatgacagcaatgtgtctttcttc
tacttaaatgtgaacaaaaccatcccagaggagtggcgtccacaggactatgtggtggtc
ggccttggactgactgtctgtgtcttcatcatcctcaccaacatcctggttatgtcagct
atatttatgaaccggcgattccattaccccatctactatctgctggggaatctggcagcc
gctgacctgtttgctggcatcgcatacatgcacctgatgttccacactggcccatggaca
aagaagctctccatataccagtggttcctccgacagggattgattgacacaagtctgacg
gcttcagtcataaacctgatggccatcgctctggagcggcaccagaccatcttcaccatg
cagctgcacagcagtatgaccaaccgccgcgtcatcctcctcatcctcgcaatctggctc
atcgccatagtgatggggctggtgcccaccatggggtggaactgcatgtgtgatctgcaa
aactgctccaaaatggcgccgctgtacagcaggagttacctggttttttgggcggtgctt
aacctcttctccttcaccgtcatggtggtagtttatacgcgcatcttcatctacgtacgg
cgcaagaacctgaggatgagccagcacacctcgcagaccaagcacaaggagactgtggtc
agcctgatgaggactgtgttcatgatcctcggatgttttgtgatctgctggactccgggc
ttggtgctcctgctgttggatggtgtgaactgcggctgtggagtgttgacctatgagaag
tacatgctggtcttggctgagttcaactccctcatgaaccccatcatctactcgtaccgg
gaccaggacatgcgccgcactttcaaacgcatcctgtgctgcctgtggccgcgtgcggga
gggcgaggccaacatgcaggtgtccgcttcaacacgcttgaacaagagacgattaggctc
cagagtggtgtcccaccgcaacagcccaaagggccccagctggtgctaagaaatgcagaa
gatctacaccactctgtccacatatga

DBGET integrated database retrieval system