KEGG   Electrophorus electricus (electric eel): 113588962Help
Entry
113588962         CDS       T05787                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee03030  DNA replication
eee03410  Base excision repair
eee03420  Nucleotide excision repair
eee03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:eee00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    113588962 (lig1)
   03410 Base excision repair
    113588962 (lig1)
   03420 Nucleotide excision repair
    113588962 (lig1)
   03430 Mismatch repair
    113588962 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eee03032]
    113588962 (lig1)
   03400 DNA repair and recombination proteins [BR:eee03400]
    113588962 (lig1)
Enzymes [BR:eee01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     113588962 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     113588962 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     113588962 (lig1)
DNA replication proteins [BR:eee03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    113588962 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     113588962 (lig1)
DNA repair and recombination proteins [BR:eee03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     113588962 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     113588962 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     113588962 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 113588962
NCBI-ProteinID: XP_026884175
LinkDB All DBs
Position
Unknown
AA seq 985 aa AA seqDB search
MQRSIASFFQPVKCKELGGQTREQSESIKSPLKTQNGGQEYDSPVKKTNKRSRPIVDSDD
EDQSTVKEVSKLDRDQADKPSKEKVVASKATINPLSPKPLVTPATPVTPATSTVSETTGS
PGSPVTPTTTSPSGIPKRKTARKQFPKRKLDSQSDGEREMEEMEREKEEPDEEREETEQE
RKRARTEEAPDHTGETEEDVMEVEGEKAVDMEQQKTDKGMKDTMKGESEKKSDVVEEEEK
NDRANGKNREMDEAKEEKCTPNRVIKKRDEEEEKRGGSAKKTVISSFFAPRKAAVKLEKS
EEKNEPEKLSSGEKAEEKEKKKSEKGVESANQGQYDPSKAHYHPIDDACWRRGQRVPYLA
VARTFEKIEEDSGRLRNIETLSNLLRSVILLSPEDLLCCVYLCLNQLGPAYQGLELGTGE
TVLMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPANLTAVGVFTKLKEI
GSMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLAALSQAVCLSP
PAAEFPPAVIDAGKVMSTESRRAWLEEKALILKQTYCEMPNYDVIIPVLLKDGIDELPHH
CRLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERAQIHIVENGEVRIFSRNQ
EDNTSKYPDITSRIPQVKRESVRSCVLDAEAVAWDREKKQIQPFQVLTTRKRKDVDASEI
KVQVCVYAFDLLYLNGESLVREPLSKRRALLRESFVEKEGEFVFARSLDSDNTETIAEFL
EQSIRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLEGVGDTVDLCVVGAYLGKGKR
AGSYGGFLLACYDEDNEEFQSVCKIGTGFKDEDLEQHYNFLKEHILPKPRPYYRVDQSAE
PDVWLDAVQVWEVKCADLSLSPVYKAAMGLVDPEKGISLRFPRFLRVRDDKKPEDATTGA
QIADLYRKQQQIQNQGEKTDLEDYY
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcattgcgtcattctttcagccggtgaagtgtaaggagctgggcggacag
accagagagcagtcggaatccatcaaaagccccctcaaaactcagaatggtggacaggag
tacgattcgccagtcaaaaaaaccaacaaacggagccgaccgatagtggacagtgatgat
gaagaccagtcaacagtaaaagaagtctccaaattggacagagaccaggcagacaaacca
agcaaagagaaggttgtagcttcaaaggccaccatcaacccactgtcaccaaaacccctt
gttaccccggcaacccctgtcaccccagcaacttcaactgtttcagaaactacaggcagc
cctgggagccctgttaccccgacaaccacctcaccctctggcatcccaaaacgaaagact
gctcggaagcagtttcctaagaggaagctggacagccagagtgatggagagagagaaatg
gaggagatggagagagagaaggaggagcctgatgaagagagagaggagactgaacaggag
aggaagagagcaagaacagaggaagctcctgaccacaccggagagaccgaggaagatgta
atggaggttgagggtgagaaggctgtggacatggaacaacagaagacagacaaaggaatg
aaggacaccatgaagggagagagtgaaaagaagagtgatgtcgtcgaagaggaagaaaaa
aatgacagagcgaatggaaagaacagagagatggatgaagcaaaggaggaaaaatgcact
cctaatagagtgataaaaaagagggatgaagaggaggaaaagagagggggatctgctaag
aaaacagtcatcagcagcttctttgcacccagaaaggcagcagtgaagctggaaaaatca
gaagagaagaatgaaccagagaagctgagcagtggagagaaagctgaggagaaggagaag
aagaaaagtgaaaagggggtggagtctgcaaaccagggccaatatgatccttccaaagct
cattatcaccccattgatgatgcgtgctggaggaggggccagagagttccatacctggct
gttgcacgtacctttgagaagattgaggaagattcaggaaggttgaggaatattgagacc
ctgtctaatctcctgcgttctgtgatcctgctctctcctgaggacctgctgtgctgtgtg
tacctgtgtctaaaccagctcggccctgcctaccagggcctagagctgggcactggggag
acggtgctgatgaaggctgttgcccaggcaacagggcgacagctggacaaaatcaaggcg
gaggctcaggaaaaaggtgatctgggattggtggccgagagctcccgcagcaaccagaga
atgatgtttgcgccagctaatttgacggctgtgggcgtattcaccaagctgaaggagatt
ggtagcatgagtggcaactctgccatgaacaagaaaattgatatcattaagggtctgttt
gtggcatgccgtttctcagaggccagatacattgtgcgatcattggcagggaaactgagg
atcggattggctgagcagagtgtcctagcagccttaagtcaggctgtgtgtctgagcccg
ccagctgcagagttccctccagctgttattgatgcagggaaggtgatgagtaccgagagt
aggagagcatggcttgaagaaaaagcactcatcctcaaacagacttactgtgaaatgcca
aactatgacgtcatcatccctgtacttctgaaggacggcatagacgaactgccacatcac
tgtcgtctcactccaggtgtgcccctgcgtcctatgctggcccatcccactaagggtgtg
ggggaggtgatgaagaggtttgacgaggccgccttcacctgcgagtacaagtatgatgga
gagagagcacagattcatattgttgagaatggtgaggttcgtatcttcagcagaaatcaa
gaggataacaccagcaaatacccagacatcacctcacgcatccctcaggtgaagcgggag
tccgtgcgctcttgtgtgttggatgctgaggctgtggcgtgggaccgggagaagaagcag
attcagcccttccaggtgctgaccacacgcaagcgtaaggacgtggatgcgtctgagata
aaggtgcaggtgtgtgtgtacgccttcgacctgctgtacttgaacggagagtctcttgta
cgagagccgttgagcaagcgccgagctctgctgagggagagttttgtggagaaggagggg
gagtttgtctttgcccggtctctcgactctgacaacaccgagaccattgctgagttcctc
gagcagtccatacgagactcatgtgaaggcctgatggtgaaaaccctggagaaagacgcc
acttatgaaattgctaaacgatctcacaactggcttaagttgaagaaggattacctggag
ggggtgggagacacagtggatctgtgtgtggtcggtgcgtacctggggaagggaaaacga
gcaggcagctatggaggttttctcctcgcctgctacgacgaggacaacgaggagttccag
tctgtctgtaagataggaacaggctttaaagatgaagatctggagcaacattataatttt
ttaaaggagcacatcctccctaagccccgcccctattacagagtggaccagtcagcagag
ccagatgtttggctggatgctgtacaagtgtgggaagtgaaatgcgctgacctatcgctg
tccccggtctacaaagcagcaatgggattggtggacccagagaaggggatttctcttcgc
ttccctcgattcctccgtgtcagagatgacaaaaaaccagaggacgctacaacaggagcc
cagattgccgatctctacaggaagcaacaacagatacaaaatcagggcgaaaagactgat
ttggaggattattattga

DBGET integrated database retrieval system