KEGG   Electrophorus electricus (electric eel): 113589005
Entry
113589005         CDS       T05787                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113589005 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:eee04052]
    113589005 (epo)
Cytokines and growth factors [BR:eee04052]
 Cytokines
  CSF and other factors
   113589005 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 113589005
NCBI-ProteinID: XP_026884244
LinkDB
Position
Unknown
AA seq 195 aa
MSLPGHEESSKIGKRSAGLFALLLIVLEWSRPGLPSPLRPICDLRVLDHFIKEARDAEAA
VRVCKEECAIAVSLLVPLTRVDFGVWEKKNMEEQALEVQTGLWLLSKAISSLRASVSNSA
LASHIDISVQNIASIGQVLRSLSIQDYVPIAGGLDIQETWRVSSASELFQVHINFLRGKV
RLLLANAPVCQQGIS
NT seq 588 nt   +upstreamnt  +downstreamnt
atgagtctccctgggcatgaggagagctccaagattgggaagagatctgctggactcttt
gccttgctgctgatcgtgctggagtggtccaggccgggcctgccctccccgctgcgtcca
atctgtgacctgcgcgtcctcgaccacttcatcaaagaggcacgcgatgcagaggctgct
gtgagggtttgcaaagaggaatgtgccattgctgtctccctcctggttcctttgaccaga
gtagattttggtgtgtgggaaaagaaaaatatggaggagcaagctctggaagtccagaca
ggcctgtggctgttgagcaaggccatcagctccttgcgtgcatctgtgagcaactctgca
ctggcatcccacatcgatatcagcgtccaaaacattgccagcattggacaagtgctgcgc
agtctcagcatacaggattacgtgccaatagctggtggtttagatatacaggagacatgg
agagtgtcttctgcctccgagctcttccaagttcacatcaacttcctgcgtggcaaagtg
cgcctcctgcttgccaatgcccctgtctgccagcaaggcatcagctga

DBGET integrated database retrieval system