KEGG   Electrophorus electricus (electric eel): 113589456Help
Entry
113589456         CDS       T05787                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00010  Glycolysis / Gluconeogenesis
eee00053  Ascorbate and aldarate metabolism
eee00071  Fatty acid degradation
eee00280  Valine, leucine and isoleucine degradation
eee00310  Lysine degradation
eee00330  Arginine and proline metabolism
eee00340  Histidine metabolism
eee00380  Tryptophan metabolism
eee00410  beta-Alanine metabolism
eee00561  Glycerolipid metabolism
eee00620  Pyruvate metabolism
eee01100  Metabolic pathways
Module
eee_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113589456 (aldh2)
   00053 Ascorbate and aldarate metabolism
    113589456 (aldh2)
   00620 Pyruvate metabolism
    113589456 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113589456 (aldh2)
   00561 Glycerolipid metabolism
    113589456 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113589456 (aldh2)
   00310 Lysine degradation
    113589456 (aldh2)
   00330 Arginine and proline metabolism
    113589456 (aldh2)
   00340 Histidine metabolism
    113589456 (aldh2)
   00380 Tryptophan metabolism
    113589456 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113589456 (aldh2)
Enzymes [BR:eee01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     113589456 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 113589456
NCBI-ProteinID: XP_026884928
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MLRTGISRTLRPVSRISACTYSAAAIPAPNTQPDIHYNKLFINNEWHDAVNKKTFPTINP
ATGEVICQVAEGDKADVDKAVKAAKGAFRLGSPWRRMDASDRGMLLHRLADCIERDAAYL
AALETLDNGKPYAVAYTVDVPMVLKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPPGVVNIVP
GMGPSAGAAIASHMDVDKVAFTGSTEVGQLIQQTSGASNLKKVTLELGGKSPNIILSDAN
MDEAVDQANMAIFFNQGQCCCAGSRTYVQESIYNEFVERSVERAKKRVVGDPFNLKTEHG
PQVDDEQYQKILSYINSGKHEGAKLLCGGSAAADRGYFIQPTIFGDVQDNMKIAREEIFG
PVMQILKFKSVEEVILRANDTKYGLAAAVFTTDINKAQYISNSLRAGTVWINCYNVFGVQ
APFGGYKASGTGRELGEYGLENYTEVKTVTIKIPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctacgcaccgggatttccagaactttacggccggtttcacggatttctgcatgcacg
tattccgctgcagcgattcctgcaccaaacactcaacccgatattcactacaacaagctg
tttatcaacaatgagtggcatgatgcagtgaacaagaaaactttccctaccatcaatcca
gccacaggggaagtcatctgccaggttgcagagggggataaggcagatgtggataaagca
gtgaaggctgccaagggtgccttccggctgggctcgccatggcgacgcatggacgcatca
gatcgtggaatgctcctgcaccgtttggctgactgcattgagagagatgctgcctatctc
gctgcactagagactctagacaacggaaagccatatgctgtggcttacactgtggatgtg
cccatggtgttaaagtgcttgaggtactatgctggttgggcggacaaatgggagggcaag
accattcccattgatggagattacttctgctacacccgacatgagcccattggagtgtgt
ggccagattattccttggaacttccctctgttaatgcaagcatggaagcttggccctgcc
ctggctactggaaacacagtcgttatgaaagtggcagagcagactcctcttactgcactc
tatgtggccagtctgataaaggaggtgggcttccctcctggtgtcgtgaacatcgtccct
ggaatgggcccctctgctggggcagccatcgcttctcatatggacgtggacaaagtcgct
tttacgggctccactgaggtaggccaactaatccagcaaacctcaggtgccagtaacctg
aaaaaagtaactctggaactaggagggaagagccccaatatcattttgtctgatgccaac
atggatgaagctgtggaccaagccaacatggccatcttcttcaaccaggggcagtgctgc
tgtgctggctcacgcacatatgtacaggagagcatttacaatgagtttgtggagcgcagt
gtggagcgagcaaagaagagagtggtgggagatcccttcaatctcaaaactgagcatggc
ccacaggttgatgatgaacaataccagaagattctgagctatatcaacagcggaaaacat
gagggggccaaactgttgtgtggaggcagtgcagctgcagaccgtggttacttcatccag
cctaccatttttggagatgttcaggataacatgaaaattgcccgtgaagagatctttggg
ccggtaatgcagattctaaagtttaagtctgtagaagaggtgattttgagagccaacgac
actaaatacggcctggccgctgccgtcttcaccacggatatcaacaaggcgcagtacatc
tctaacagtcttcgtgctggcacagtctggattaactgttataatgtatttggagtccaa
gctccctttggtggctacaaggcatctgggactggacgtgaactaggagaatatggcctg
gaaaactacactgaagtcaaaacagtgacaattaaaatccctcagaaaaactcgtaa

DBGET integrated database retrieval system