KEGG   Electrophorus electricus (electric eel): 113589513Help
Entry
113589513         CDS       T05787                                 

Definition
(RefSeq) microsomal glutathione S-transferase 3-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00480  Glutathione metabolism
eee00980  Metabolism of xenobiotics by cytochrome P450
eee00982  Drug metabolism - cytochrome P450
eee00983  Drug metabolism - other enzymes
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113589513
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113589513
   00982 Drug metabolism - cytochrome P450
    113589513
   00983 Drug metabolism - other enzymes
    113589513
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eee02000]
    113589513
Enzymes [BR:eee01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     113589513
Transporters [BR:eee02000]
 Other Transporters
  Pores ion channels [TC:1]
   113589513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 113589513
NCBI-ProteinID: XP_026885014
LinkDB All DBs
Position
Unknown
AA seq 140 aa AA seqDB search
MEILDVLPANFGYAILTYLYSFIMLFYLAMKVGAGRKKYGVKYPTMYSDKEVVFNCIQRA
HQNTLEVYPQWLVFQTIAALVYPTVASVLGVIWVTSRFSYAWGYYTGDPAKRMNGVYGYI
GLFGVIILSIYIALQLLEVF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggagattttagatgttctgcctgccaactttggctatgcgattctgacatatttgtac
agttttataatgttgttttacctcgcaatgaaagttggtgctggccggaaaaaatatggc
gtgaaataccccactatgtacagtgataaggaagtggtgttcaactgcatccagagggca
catcagaacacgctggaggtctatccacagtggttggttttccagactattgctgcactt
gtatatcctactgtggcctctgttctgggggttatctgggtgactagtaggttctcctat
gcatggggctactacactggtgatcctgccaagagaatgaacggtgtttatgggtacatt
ggcctttttggagtgatcatcctgtctatatatattgctctccagctccttgaagtcttt
taa

DBGET integrated database retrieval system