KEGG   Electrophorus electricus (electric eel): 113590062Help
Entry
113590062         CDS       T05787                                 

Definition
(RefSeq) uncharacterized protein LOC113590062 isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    113590062
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eee03036]
    113590062
Enzymes [BR:eee01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     113590062
Chromosome and associated proteins [BR:eee03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     113590062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET CRAL_TRIO_N
Motif
Other DBs
NCBI-GeneID: 113590062
NCBI-ProteinID: XP_026885820
LinkDB All DBs
Position
Unknown
AA seq 2190 aa AA seqDB search
MDGPYRMSVRELCETDDLATSLVLDPLLGFSTHKMNISPLPEIRRWSYLRETLLRFCRTR
DFQATFDALLDGEWTSNYFPSLGTHRQELLRQHMYRYLTAFLLDSGVQIESCDRYSSETN
GAKITATRHWSIGERVEVLQGCIAELSPADGAVLRAGVNDFSVMYSTRKQCAQLWLGPAA
FINHDCRPNCKFVPGDKNGACVKVVRPISPGEEITCYYGDSFFGEDNEMCECYTCERRGE
GFFRQRLDRLPEWVGSSDPLGQKYKFRETDLRLNRGKGNSTPKGFLTVTNPACSVRNSFS
QQMKRNAPTVSSRTTKTKRWKREEEQTKQAEKRRDDHLISSLSSCSLRDFSVCLYNHTVD
FLLSCKDPTSKERALLERIESKRPNPDRANNGLSFLTPTAVEPQGGEERQDISSDLLSSN
PAAELNLKPFALTSISSICDTNCPKSKGRNMDARAVRVVHQMAISSRTRNMLRSRLRGGV
RAFEHSKLSRLSKKAVKMISQTSNVHVNRRDPPRQRGSVSELRNGRRHITVKMDKSRLCK
TYLGRGGGNNSKSSQSQAVTQEEHCSFGDSDKEEADGNKCITGAAREGGLNSLTASETSG
EKENKHRPSVVSGAITVASPSPPPPSCPPLSLPSGLTRYVKVSLVRVSIPGEVGAAGRAK
QGQADSSGEPEFSPPAAGEQEDSKCQGMARAEGKRGVREMYFTPVNMGSADRYLKVTCGL
LQCDIESTKNAAITQTAAKEVEEDSKWGRVGEETGEEKGSGDNRVSADSVGVETALNEEG
LVTRVEKRQHSPRSETKEGVKSTAEGEDKEESEADKQGKGTSQRACTVQKNMDLLVHFGS
KTIVIKEAKVLLSDIFKSISSKPIRQQQDSKGYNSILRNPSSQRADKKWTQCIKRLKSLT
SHGEREGLNEGCDPVKKNAGPFTQIVTESKCNTEALGLADVGGAQIAQKAAVEAQPSSEP
LSPAKGSVDHSLQSSIPLKKRAFRESIDADPADQDVIAAVMEPACATKCVASRLDSLLPA
SQGNSSVDAEAQNLTLELSPTFKAETVGSKKRAATIRPSKTSALRKLHPRKKMRSFQARL
VQEHGKKLRDRDSTSILPVEKSPERSANNKKNSKHTSELESIVEYVDAVEEMRERVRGGQ
GDSQKVLEKTAEFTEHGSAENNAELPAPESPVNTEDKQSPKLRIRLKRKGGKEWEMETTH
KRDSAVGETPSLLPRADAIDPFKAILDSVAILNLEMERIRGHGEVDKTVGLEKATKAVQD
VLEHCRKEGSIKPRKRHKKIPSIGVDTKKHVKGQGSSVEGKSIVPGVPQRQSVLVKHLKV
EADSADIKPLPLLRLRRRAEGRWEVEGEQAPKQDTNKGPGSSVLREPRGPTCISPGTPVL
GDTDASKVKQETLSPCQHQAIAGSGDETREFSKGATSSEPPPLLLSLSPLSLNSPYHEGL
TEVARINGRVDLKERGREAKAPENIGRKETPVAGGMTKAELKERSEVCLSHNLLQINRSL
SKLQAMSQQQPPERSGSASTSATTTSCPIQSRPLSPPTSPFTTECSFSNYSEDILDFQCL
NLESYDQAHTQNSLPSSLTDYCPGEPHNTGSFSSPFSQSPNDGWNPETPYLGSPSPGRSF
SPAEDLSFADLGLSREDAPLLNSGPFFSSKEKTFTPVTSLAFAKDCERNTSFFDGLLTKR
NLIFQNKDDSATPLVCLADKTLGNQRDLIFNPSSSNKQTAPPSCVQSQDKLSFLDSSKNL
STPADFARNQAKDKTSGPLHFHGLAHKSQPVFLSQSAQNLYNASSLGNPVKPFHSLHTGS
KAMSSSELPGALNLGSVRLRGHEKKSAFFHNSLVKLEGGYGQTVSKTSSIGDPKLSSKFH
GTRSELTDPAPGQSNLHKDPSADVLQSGYLKYLENSRRGTKTVTPHKGLSEAHPQTDKVY
PVYFFSSNKTPVNVVKNSTVEKPQNSRFNNSPNMPCNIFSSSSSPQSYSVPHCKPSRQDK
PHAVVAPSQNSQPPFPLDKSQLCFSHCDPLDVNLSCSLSPNVSQHGSPHMGYRDSVAQEI
PVTKAQPSSFVYSQSAHPSYVVNFTGDHSVTLDYTDDGDCLNYSSSVPTNYTYHCLMEPS
GTQGRLILEPCGPTSISHSPSLGSFTGHKGQPEQSSKVPQHHGQPGGHPIISHHFPPSNS
QNTSVTDRKPKRLRLVVTDGTVDLDLQYTD
NT seq 6573 nt NT seq  +upstreamnt  +downstreamnt
atggacggaccatatagaatgagtgtgagagaactgtgcgagacggatgatttggccacc
agtctggtgctggatcctttactggggttcagcacacataagatgaatataagtcctctg
ccagagatccggcgttggagctacctgagggagactctgctgcgcttctgtcgcaccagg
gacttccaggccacgttcgacgcactgctggacggagagtggaccagcaactacttccca
agcctgggcacgcaccggcaggagctgctgagacagcacatgtaccgctatcttacggcc
ttcctgttggacagtggagtgcagattgagtcatgtgaccggtattcatcagaaaccaat
ggggccaaaatcacagctacaaggcactggtcaattggagagcgtgtggaggtgctgcag
ggctgcattgctgagctgagtcctgccgatggcgctgtgctaagggcgggagtgaatgac
ttcagtgtgatgtactctacacgtaagcagtgcgctcagctctggctgggacctgctgcc
ttcatcaaccatgactgcagaccgaattgcaagtttgttcctggggataagaacggagca
tgtgtgaaagtggtccggcccatctcgccaggggaggagatcacatgttactatggcgac
agcttttttggggaggacaatgagatgtgtgaatgttacacctgtgagaggagaggggag
ggattcttcagacagaggctggatagactgccagagtgggttggctccagtgatccttta
ggccagaaatacaaattcagagagacagacttgaggctgaaccgagggaagggaaacagc
actccaaagggatttctcactgtaacaaatccagcttgctctgtgaggaattccttttcc
cagcagatgaagaggaacgcccctacagtgagcagcaggacgacaaagaccaagaggtgg
aaaagggaggaggagcaaaccaaacaggcagagaagaggcgagacgaccatctcatctca
tccctgtcttcctgcagtctcagagacttcagcgtctgcctgtataatcacacagtggac
tttctcttaagttgcaaggaccctactagcaaagagcgagccctgctggaaaggatagag
agcaagagaccaaaccctgatagggcaaacaacggactgagctttctgacacctactgcc
gttgaaccacaaggaggtgaggagagacaggacatttctagtgacttattgagtagtaat
cctgctgctgaattaaacttaaaacctttcgctttaacatccatttcgagcatatgcgat
actaactgtccaaaatctaagggacggaacatggatgctcgggcagttagagtcgttcat
cagatggccatttcctcgaggacccggaatatgcttcggagtcgactaaggggaggtgtc
cgagcctttgaacattctaaattgtctcgcttgagcaaaaaggcagttaaaatgatcagc
cagacatctaatgttcatgtaaaccgcagagatccccctcgtcagagagggagtgtctct
gagctcagaaatggtcgtaggcacattaccgttaagatggataagtcacgtttgtgcaaa
acgtaccttggtaggggtggaggaaataacagtaagtcatcacagtcccaggcggtcaca
caagaggaacattgcagctttggggacagtgacaaggaggaggctgatggcaacaagtgc
atcacaggcgctgctagggagggaggtttgaactccctgactgcctcagagacctcgggg
gaaaaggagaacaaacacagaccttctgttgtttctggcgccatcactgttgcatctccc
tcgccgcctccccccagttgccctcccctctctctcccttcagggttaacgcgctacgta
aaagtcagcctggtcagagtgtccatcccaggagaagtaggagcagctggcagggcaaag
cagggccaggcagatagcagtggagagccagagttctcaccaccagcagctggagagcag
gaggattcaaagtgccaaggtatggctagagctgaaggtaagagaggggtgagggaaatg
tactttacaccagtaaacatgggaagtgcagacaggtatttaaaagtcacatgtggttta
ttacagtgtgatatagaaagtaccaaaaatgctgctatcacacaaactgctgccaaggaa
gtagaagaggatagtaagtggggtagagtcggagaggaaactggggaagagaagggaagt
ggtgataatagagttagcgctgattctgtcggtgttgaaacagctttgaatgaagagggg
ttagtgaccagggtagagaaaagacaacattcaccaagaagtgaaacgaaagagggtgtg
aaaagcacagctgaaggggaagataaggaagagagtgaagctgacaaacagggcaaggga
accagccaaagagcctgtacagtacaaaagaacatggatttattggtacattttgggagc
aaaaccattgttataaaggaggcgaaagtccttctgtctgacattttcaagagcataagc
agtaaaccgatcagacaacaacaggatagcaaaggatacaatagcattctcaggaatccc
tcgtcccagcgtgcagataaaaaatggacccagtgtattaaaagactgaaatcccttact
tctcatggagagagagaaggtttgaatgaaggctgcgatccagtgaaaaaaaacgcaggt
ccctttactcagattgtgactgaaagtaagtgtaatacagaggccctgggtttagctgac
gtgggcggagcacagatagcccagaaagcagcggtggaagctcagccctcttcagagcct
ctctctcctgctaagggtagtgtggatcacagtctccagagcagcatccccctaaagaaa
cgtgcatttcgggagtccatcgacgcagatccagcagatcaggatgtgatcgcagctgtg
atggagccggcatgtgccactaaatgtgtggcgagcaggctggacagtctgttgcctgca
tcccaagggaacagcagtgttgatgctgaagctcagaacttaaccttagagctgagccca
actttcaaggcagagactgtaggatcaaagaagcgtgctgcaacaatcaggccatctaaa
acttcagcactccgaaagcttcatcccagaaaaaagatgcgatcttttcaagctagacta
gtgcaagagcatgggaagaagcttagagacagagacagcacaagtatcttaccggtagag
aagagccctgaacgtagtgcaaataacaagaagaactccaaacatacctctgagctggaa
agcatagtggagtatgtcgatgcagtagaagagatgcgtgagagagtgagagggggacaa
ggcgatagtcagaaagtgctagagaaaacagcagagtttactgagcatggctcagcagag
aataacgctgagttacctgccccagaatctcctgtaaatacggaagacaagcagagccct
aagttaagaatacgactgaaaagaaaaggggggaaggaatgggaaatggagactacacac
aagcgcgacagcgctgtgggtgaaacgccaagcctactgccacgtgctgatgcgattgac
ccctttaaggctattttagactccgttgcaattttaaacttggaaatggagaggattcga
ggtcacggagaagtagataaaactgtgggattggagaaagcaacgaaagctgttcaagac
gtcttggagcactgcagaaaagaaggctcaatcaagccaaggaaaagacacaaaaagata
ccatccattggcgtcgacaccaaaaagcatgttaaaggacaaggaagctctgttgaaggt
aaaagcattgttcctggtgtgcctcagcggcagagcgtgcttgtgaaacatctcaaagtg
gaggcggacagtgctgatattaaacctctacctcttcttcgtttgcgccgcagggccgag
ggcaggtgggaggtggagggcgagcaagctccgaaacaggacacaaacaagggcccaggc
agttccgtgctgagggagccgagaggcccgacatgcatctctcctgggacgccagtactg
ggagatacggatgccagcaaagtgaaacaggaaactttgtctccctgccaacaccaggcc
attgctggcagcggtgatgagactagagagttctctaaaggtgcaaccagttcagagcct
cctcctcttttattatctctctcacccttgtctctaaattctccgtatcatgaaggactg
acagaagtggcccgtattaatggaagagttgacctcaaagagagaggtagggaagccaaa
gcaccagagaatatcggaaggaaggagacccctgtggcaggagggatgacaaaggctgag
ctcaaagagagaagtgaggtttgcttgagtcacaacttattacagatcaacagaagcctt
tctaaacttcaagccatgagccagcagcagccaccagagaggagtggctctgctagcacc
agtgcaacaactacctcctgtccaattcagtcaaggcctttgtctcctcccacttcaccc
tttaccacagagtgctccttttccaactattcagaggatattttagattttcagtgcttg
aatcttgaaagctatgatcaggcacacacacaaaacagcctgccaagttcattaacagat
tactgccctggggaaccacataacactggatcttttagtagccccttctctcaaagccca
aatgatggatggaacccagagactccataccttggctccccgagtccagggaggagcttt
agtccagctgaagacctcagtttcgctgatctgggcctttcaagagaagacgctccgttg
ttgaacagcggccctttcttctcttccaaagaaaagacatttactcctgtgacgagttta
gcatttgctaaagattgtgaaagaaatacatcattttttgatggtctgctcacgaaacgt
aacctgattttccagaacaaggacgattctgcaacacctctggtctgtttggcagataaa
accttaggcaaccaaagggacttaatatttaatccatcctcaagtaataagcagacagcc
cccccttcttgcgtacagtctcaggataagctcagttttcttgatagctcaaagaatcta
tcaaccccagcagactttgccagaaaccaagctaaggacaaaactagcgggccgctccat
ttccatggcttagctcacaaatcacaacctgtctttttgagccagtcagcgcagaacctc
tacaacgctagctccctgggtaatcctgtgaagcccttccattcccttcatacaggaagc
aaagccatgtcgagctcagagttgcctggggcccttaaccttggcagcgtgcggctccgt
gggcatgagaaaaagtctgcgtttttccacaatagtttggtgaagcttgaaggaggatat
ggtcagactgtttctaaaacttcctcaataggtgatcctaagctttcttcgaagttccac
ggcaccagatctgaacttaccgaccctgctccaggtcagtctaatttacacaaagatcca
tcagctgatgttcttcaaagtggatatctgaaatatttagaaaactcaaggagaggcaca
aagaccgttacaccacacaaaggactatctgaggcccacccacaaaccgacaaagtttac
ccagtttactttttcagctctaacaaaactccagtgaatgttgtcaaaaactcaaccgta
gaaaagccgcagaattctaggtttaacaacagtcccaacatgccatgcaacattttttca
tctagctcaagtcctcagagttacagtgtacctcactgtaaaccgtcgaggcaggacaaa
cctcacgctgtggtggctcccagccagaactctcaacctccttttcccctggacaaaagt
cagctgtgtttctcacactgtgatcccttagatgttaacttaagctgctcgctttccccc
aacgtttctcaacatggtagcccacacatgggctacagggattctgtggcccaggaaatc
cctgtaaccaaagctcagccatcctctttcgtgtacagccagtcagctcacccgtcatac
gtcgtgaacttcacaggcgatcactctgtcaccctggactacactgatgatggggactgc
ttgaattactcctcatcagtacccacaaattacacttaccattgtcttatggaaccttcc
ggaactcaaggaaggctcatcttagaaccatgtggtcccacaagcatctcacattctcct
tctctgggcagctttacaggacataaaggccagcctgagcagtcgagtaaggtccctcag
catcacgggcagcctggaggccatccgatcatttcccaccacttcccaccgtcaaactct
cagaacacgtctgtgacggaccgtaaacccaagaggctaaggctagtggtaacggatggt
actgtagacctcgatctgcagtacactgattaa

DBGET integrated database retrieval system