KEGG   Electrophorus electricus (electric eel): 113590290Help
Entry
113590290         CDS       T05787                                 

Definition
(RefSeq) transmembrane channel-like protein 2-B
  KO
K21988  transmembrane channel-like protein
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eee02000]
    113590290
Transporters [BR:eee02000]
 Other Transporters
  Pores ion channels [TC:1]
   113590290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TMC OAD_gamma
Motif
Other DBs
NCBI-GeneID: 113590290
NCBI-ProteinID: XP_026886154
LinkDB All DBs
Position
Unknown
AA seq 939 aa AA seqDB search
MVGKGSKLVLLSGVEDTSQPVPVLGLKDTTLPVPVPVPHTRPGPMAIPPVLPDPPSRHLR
TYRLSYSPCCGSMTLDCDYDSIARTGELLQGVSQVPLLAEAEAENWLSEAHSLTATMPLK
KSDIVIAMTKAGMEMDAEYDSESDEYCNVRAKGNKEAKHAVCRKTQWWAADSEEEEEEEE
EEEEGGSDGRRDARAKTAGEKTVAEKGGARRRREEEEEEERNKGGKETCTGKKRRKGNSS
SSYSSSDSNSESLSGGELAQLQEELEEKKKLISTLRSKPWHMKRRLHSLKKAQEFVEASE
SVLGSAKGTNTRFFKTMINKKLIKFNLELENLKTMITPWQGKIKEVESQYGSSVASYFIF
LRWMYVVNLVPFVLVVGLIIIPETLWGVPYGTIPRKTVPRNEQANAMDFDVLYEYGGYLK
YSAFFYGYYDNKEKIGFFGYHLPLAYLLVGLVIFFYILVVLIRVMAKNASEANSIRDEDA
FKFSWNVFTSWEYLIGNTETAEEKSAAITFVLKESLVDELRHFKNEDLNTRLFLRFVANV
LILSCLMGSGYLIYSVAKRHQTFSKMDRNQVSWLQKNEVEIVISLLGMFCPALFETIAEL
EDYHPRIALKWQLGRLFALFVGNIYTFVFTIIEDITDQLQVEKTIKNQSIIALQQYYANY
TLHHNVTENIPPPNIDPADVIRGPCWETQVGIGFMKLIISDIQVTYINILITDTIRAVVV
RYLNYCWCWDLEATFPCYGQFDISTSVLGIIFNQGMVLMGTFYCPGLMSVNILRLVISMY
FQCWTLKSSNIPNRNIFKASRTSNIYMGILLFVLFVCLIPVIVIIMTMLPSFDCGPFSGK
NKMYDVLTDMILEFPAFMKTFINFVFNPGVVMSVLILMALIIYYLQKVSTGYHKTNMELK
KRLEKEKEKKKKYRTNKVINDEKDVLSDRALISEQTLGQ
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggtaggcaaagggagtaaactggtgctactctctggtgtggaagacaccagccagcca
gttcctgttttggggctgaaagataccaccctgccagttcctgttcctgtgcctcacacc
aggcctggtcccatggccattcctccggtcctgccggacccaccatcgcgacaccttcgg
acctaccgcttgtcgtactctccgtgctgtggctctatgaccctggactgtgattacgac
tccattgcgagaactggtgagctgctgcaaggtgtgtcccaggtgcctttgctagcagaa
gcagaagctgagaactggctgagcgaagctcactcactgaccgccacaatgccacttaag
aaaagtgatatcgtaatagccatgaccaaagctggaatggaaatggatgcggagtacgac
agcgaaagcgatgaatattgcaacgtgagggcgaaaggcaacaaggaagccaaacatgcc
gtctgtcgaaagacacagtggtgggcggcagacagcgaggaggaggaggaggaagaggag
gaggaagaggagggtggcagtgatgggcgacgtgacgcgcgggcaaagacggccggcgag
aagacggtggccgagaagggtggggcgcgaagacgacgcgaggaagaggaggaggaagaa
cgcaacaaaggagggaaagaaacgtgcactggaaaaaagcgaagaaaagggaacagcagc
agctcgtactcatcaagtgactcaaactccgagtccctgtcgggaggagaactggctcag
ctgcaagaagaactggaagagaagaagaaactgatcagcacgctccggagcaagccatgg
cacatgaagagaagactccatagcttaaagaaagcccaggagtttgtagaggcatctgaa
agcgtattgggaagtgcgaaggggacgaacacccgcttttttaaaaccatgattaacaag
aaactgatcaagttcaatctagagttagaaaacttgaagactatgatcactccctggcaa
gggaaaattaaagaagtagaaagtcagtatggctcttctgtagcctcctacttcatcttc
ctcaggtggatgtatgtcgtcaatcttgttccatttgtcttagtggttgggcttattata
attcctgagactctgtggggggtgccatatggcaccatcccaaggaagacagtccctaga
aatgagcaagccaatgccatggacttcgacgtcctctatgaatatggcggttatttgaag
tactcagctttcttttatggttactatgacaacaaggaaaagattggattctttgggtac
cacctacccctggcatatttacttgttggacttgtaattttcttctacatcctggtggtt
ttgattagggtgatggcgaagaatgccagtgaggcgaatagtattagagatgaggatgcc
ttcaagttctcctggaatgttttcacaagctgggagtacctcattggaaacacggagaca
gcagaggagaaaagtgctgccatcacatttgtcttgaaggaatccttagttgacgaactg
aggcacttcaagaacgaggacctgaacacgcggttgtttctgcgttttgtcgctaacgtg
ctgatcctgtcctgcctgatgggcagtggatatcttatatattctgtggcaaaaagacac
caaacgttttctaaaatggaccgcaatcaggtatcctggttacagaaaaatgaggtggag
attgtcatctcactgctgggcatgttttgtccagcactgtttgagaccattgctgagctg
gaggactaccacccccgcatcgccctcaaatggcagctgggacgactctttgcccttttc
gttggcaacatttacaccttcgtgtttactattattgaagacatcactgaccagctacag
gttgagaagacaataaagaatcaaagcatcattgccctgcagcagtactatgctaactac
acactgcaccacaacgtgactgagaacatccccccaccaaacattgaccctgctgatgtc
atcaggggaccctgctgggagactcaagtgggcatcgggtttatgaagctaataatatca
gatatacaagtgacgtatattaacatcctgatcacagataccatcagagctgtagttgtt
cgctacctcaactattgctggtgctgggacctggaagccacatttccctgttatggacag
tttgatatcagtacaagtgtacttgggatcattttcaaccagggaatggtcttgatgggt
acgttctattgtccagggctgatgagtgtaaatattctacgcctggtcatttccatgtac
tttcaatgctggactttaaaaagcagcaatattcccaacagaaatatattcaaggcctca
cggaccagcaacatctacatgggcattcttctgtttgtgctgttcgtctgtctaattcct
gtgattgtcatcatcatgactatgttgccatcctttgactgtggacctttcagtgggaaa
aataagatgtacgacgtcctcaccgatatgatcctggagtttccagcttttatgaaaact
ttcatcaactttgtatttaacccaggagtcgtcatgtcagtgctgatattaatggcgctg
attatctactacctgcagaaggtatctacaggctaccacaaaaccaacatggagctgaaa
aagagattggaaaaagaaaaagaaaaaaagaaaaaatacaggaccaacaaggtaatcaat
gacgagaaggatgttctgtctgacagagccctgatttcagaacagactctaggtcagtag

DBGET integrated database retrieval system