KEGG   Electrophorus electricus (electric eel): 113591429
Entry
113591429         CDS       T05787                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00220  Arginine biosynthesis
eee00330  Arginine and proline metabolism
eee01100  Metabolic pathways
eee04020  Calcium signaling pathway
eee04146  Peroxisome
eee04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    113591429
   00330 Arginine and proline metabolism
    113591429
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    113591429
   04020 Calcium signaling pathway
    113591429
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113591429
Enzymes [BR:eee01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     113591429
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 113591429
NCBI-ProteinID: XP_026887714
LinkDB
Position
Unknown
AA seq 1004 aa
LSENIVDRCPFPVHVRNFVNGSQYKDSLFHRAVKSRSCESKICKGSLMVPKALTRFPSDT
SPAANILTQAISFINQYYRSFKNHKKEEHLARVDEVTREVETTGSYQLTTEELTFGAKQA
WRNAPRCIGRIQWSNLQLFDARKCRTAKEMFQYLCAHIKFATDGGNIRSTITVFPQRTGG
QHDFRIWNSQLIRYAGYQMEDGTVIGDPVNVEFTEICTELGWTPKYGSFVVLPLIVEANG
EDPELFEIPPELVLEVQMEHPRTFCLGFSLEEKLLLRTVLQWFPTTQPKPATESFMHHME
NEVHLRGGCPADWIWLVPPMSGSLTPVFHQEMISYILSPFFYYQSDAWLTHVWKDETKGL
KKQKKRITFNALAKAVVFSQMLMQRALMKRVPCTILYATETGKSQTFAKKLKSVLSCALN
PRLLCMEDYNFAELEKEHLLLVVTSTFGNGDSPGNGESFKKQLTGMKSLSTSIRYGVFGL
GSRMYPQFCAFSRTVDAKLAELGAKCVTSTGEGDELNGQEEAFSAWACTAFKDVCKEFGI
DGKLSGHQSLTENWDPLRHRVQFDSSVFEHIPALSALHSKAVLPLTLKWRKNLHSSQSRC
SAILVELETAGEKQVLNYAPGDHVGVFPENSSELVTGILKQVTSAPPTNQSLRLENLPAS
SFGGVVWQTDERIPACTLTQALTYLLDINTPPSQGFLRKLSQMTKEQNDQQRLLALALDL
KAYSDWKAFRRPNFLEVLEEFPSLELSAAFLLSHLPLLKPRLYSISSSPDLHPHELDLTV
SVINYRTQDGKGPLHHGVCSTWLNTMKEGQFVPCFIHRSNDFHLPSDPCSPILLIGAGSG
IAPFRSFWQQRFYDMEKTGLNKGPMMLVFGCCKADTDHLYKEETFEMKEKGILKSISVAY
SCQPGHPKVYVQHVLKKQLSKEVMQVLHQSRGHLYVCGGMNMAQDVAHTIQEILARRLGT
SLTQAQEYLEQLKAEKRYHEDIFGGQWHNALPLWSSVTFLSKNK
NT seq 3015 nt   +upstreamnt  +downstreamnt
ttgtcagagaatattgtagatcgatgcccgtttccagtacatgtgcggaacttcgtgaat
ggctcgcaatacaaagactcacttttccacagagccgtgaagagtcggtcctgtgaatca
aaaatttgcaagggctccttaatggttccgaaagcgttaacgcgcttcccaagcgacacc
tcgcctgccgcgaacattctcactcaggcgatcagcttcatcaaccagtactacagatct
ttcaaaaaccacaaaaaggaagagcatttggctcgtgttgatgaagttacccgggaggta
gaaactacaggatcttatcagctcaccacagaagagctcacgtttggggccaagcaggca
tggaggaatgcaccaaggtgtattggccggattcagtggtccaatttacagttgtttgat
gcacgcaaatgcaggaccgccaaggaaatgtttcagtacttgtgtgctcatataaaattt
gccacagatggtggcaatataagatcaaccattaccgtgttccctcaaagaactggtggc
caacacgatttccgtatttggaatagtcagctcataagatacgctggctatcagatggag
gatggcactgtgataggggaccctgttaatgtggaattcacagagatttgtaccgagctt
ggatggacaccaaaatatggctcctttgttgtgctgccactgattgtggaggccaatggc
gaggatcctgaactgtttgaaatcccccctgagctggtactggaggtccaaatggagcat
cctcgtacattctgtttggggttttcattggaagagaaacttctgctgagaactgttctt
cagtggttccccactactcaaccaaaaccagccactgagtctttcatgcatcacatggag
aatgaagtgcatctgcgtgggggctgccccgctgactggatctggctggtgccacccatg
tctggatctcttacccctgtgttccaccaagagatgatcagctatatcctctcccctttc
ttttactaccagagtgatgcttggttaacacatgtgtggaaagatgagacaaaaggactg
aaaaagcaaaaaaaaagaatcaccttcaatgccttggcaaaggctgttgttttctcccaa
atgctcatgcaaagagccttgatgaagagagtgccttgcaccattctctacgctactgaa
acaggaaaatcacagacctttgccaagaagctcaaatcagtactcagctgtgccttgaac
cccaggttactttgcatggaggactacaattttgctgagcttgagaaagagcatctgttg
ctggtggtaacaagcacttttggtaatggagacagtccaggcaatggagaaagtttcaag
aagcagctcacgggtatgaaaagcctcagtactagcatcaggtacggcgtcttcggcttg
ggctctcgcatgtacccccaattctgtgccttttcccgtactgtggatgccaagttggca
gagttgggagccaagtgtgtgacttccacaggagaaggagatgagctgaatggtcaggag
gaggctttctctgcatgggcctgcacagcattcaaggatgtgtgtaaggagtttggcatt
gatggtaagctctcagggcatcagagtctaactgagaactgggatcccctgagacacaga
gtacagtttgacagcagtgtctttgaacacatcccagctctctcagcactccactctaag
gctgtattacctttgacactgaagtggaggaagaacctacacagctctcagtcgagatgt
tctgctatactggttgagctggagacagctggagagaaacaggttctgaattatgctcca
ggggatcatgtgggtgttttcccagagaactcatctgagttggtgactggcattctgaag
caagtcaccagtgccccgcccaccaatcagagtctccgccttgagaatctccctgcctcc
agctttgggggtgtggtatggcagacagatgagcgtatcccagcatgcactctgactcag
gctcttacttacctcttggatatcaacacgccaccttcccaaggatttctgcgcaagctc
tcgcaaatgaccaaggagcaaaatgaccaacaacgcttgctagcacttgcattggacttg
aaggcttactcagactggaaggcattccgccgacccaacttcctggaggtcctggaggaa
ttcccctccctggaactctctgcagcttttctcctcagccatcttcccctgctgaagccc
cgcctctactccatcagctcctcccctgacctccaccctcatgagctcgacctcactgtg
tccgtgatcaactaccgaacccaggatggaaagggtcccctgcatcatggtgtctgcagc
acttggctcaacaccatgaaagaaggccaatttgtaccctgcttcattcatagatccaat
gacttccaccttccatcagatccatgttctcctattctcctaattggagctggaagtggc
attgcccccttccggagcttctggcaacagcgcttctatgacatggagaagacaggtttg
aataagggtccaatgatgctggtgtttggctgctgcaaagcagacacagatcacctgtat
aaagaagaaacttttgagatgaaagaaaaaggcattctgaagagcatcagtgtagcatac
tcttgccagcctggtcaccccaaggtctatgttcagcatgttctgaagaagcagctcagt
aaggaggtgatgcaggtcctccatcagagccgtggacacctgtatgtgtgtgggggaatg
aatatggcccaggatgttgctcacaccatacaggagatcctggccagacggctgggcaca
agtctcacccaggctcaggaatatctggaacaactaaaggctgagaagaggtatcatgag
gacatctttggaggccagtggcataatgctctgccactttggagttctgtaacttttctt
tcaaagaataagtaa

DBGET integrated database retrieval system