KEGG   Electrophorus electricus (electric eel): 113591526Help
Entry
113591526         CDS       T05787                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00010  Glycolysis / Gluconeogenesis
eee00030  Pentose phosphate pathway
eee00051  Fructose and mannose metabolism
eee00052  Galactose metabolism
eee01100  Metabolic pathways
eee01200  Carbon metabolism
eee01230  Biosynthesis of amino acids
eee03018  RNA degradation
Module
eee_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113591526
   00030 Pentose phosphate pathway
    113591526
   00051 Fructose and mannose metabolism
    113591526
   00052 Galactose metabolism
    113591526
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    113591526
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eee01009]
    113591526
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:eee03019]
    113591526
Enzymes [BR:eee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     113591526
Protein phosphatases and associated proteins [BR:eee01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113591526
Messenger RNA biogenesis [BR:eee03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     113591526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 113591526
NCBI-ProteinID: XP_026887853
LinkDB All DBs
Position
Unknown
AA seq 791 aa AA seqDB search
MPDSKKFFENLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVRAKVYFIHEGYQGMVD
GGDNIKEATWESVSSMLQVGGTVIGSARCKDFRTHEGRLRAALNLVRLGITNLCVIGGDG
SLTGANLFREEWNGLLKELVELGQIDEAAAEMHSVLHIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPEDGWE
DQMCQKLSENRADKKRLNIIIVAEGAIDSHNRVITTDYVKDLVVGCLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEASSDTPACVVSLCGNQAVRLPLMECVQMTQAVQK
AMDKKNFEEAVKLRGRSFENNLNTYKLLSYRKTDSVMPKSAFNVAVLNVGAPAAGMNAAV
RSAVRVGITEGHTMFAVHDGFEGFSNGQIKEIKWGDVGGWTGQGGSLLGTKRTLPVKHMD
KIAEQMRIHNINALLVIGGFEAYLGLLELLAARFRHPELCVPMVMIPATVSNNIPGSDLS
IGADTALNAITATCDRIKQSASGTKRRVFIIETMGGYCGYLATVGALAAGADAAYIYEEP
FDIRDLQCNVEHLTEKMKTSIQRGLVLRNECCNDNFTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNYGTKIAAKAMQWISKKLKEFYVEGKGRVFANTEDSACLLGMRRRA
LVFQPVTQLKDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDAGQLEHVAGLRTIE
ENGREKEGEEE
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgccagattctaaaaaattcttcgagaatctttccggagccggaaaggccatcggcgtc
ctcacgagcggcggggatgctcaaggaatgaatgcagctgtaagggcagtggtcagaatg
ggaatttatgtaagagcaaaagtgtatttcatccacgagggttatcagggcatggtagat
ggaggtgataacatcaaggaggctacatgggagagtgtctccagtatgctgcaagtgggc
ggcactgtgattggcagtgcacgctgtaaagatttccgaacacacgagggccgtctccgc
gcagcattaaacttggtgcgcctcggaatcacaaatctttgtgtgattggtggagatggc
agtctgactggggctaatctattcagagaggaatggaatggcctattaaaggagcttgtg
gaattaggtcagatagatgaggcagcagctgaaatgcactctgtgcttcacattgtgggc
atggtgggctccatagataatgacttctgcggaacagacatgaccattggcactgactcc
gccctgcacaggatcatagaggtggtggatgccataatgaccacagcacagagccatcag
agaacatttgtactggaggtgatgggcagacactgcgggtatcttgccttagtcagtgct
ttagcctgtggtgcagactgggtgctgattcctgaaatgcctccagaagatggctgggag
gaccaaatgtgtcaaaaactatcagagaaccgagcggataagaaaaggcttaatatcatc
atagtagcagagggagccatagactcacacaaccgggtcataactacagactatgtgaag
gatctggtggtgggatgtttaggctttgatacacgcgtcaccatcctgggccacgtgcag
aggggaggcacgccttctgccttcgacagaatcctggccagtaggatgggggtcgaggca
gttttagcccttttggaggcatcttcggacactcctgcctgtgtggtgtctctatgtgga
aaccaggctgtgaggctgcctctcatggagtgtgtgcagatgactcaggcagtacagaag
gccatggataagaagaactttgaggaagccgtaaaactgcgtggcaggagttttgaaaac
aacctgaacacctacaagctgctctcttaccggaaaacagactcagtgatgccgaagagt
gcatttaatgtggctgtgctaaacgtgggagccccagcagcagggatgaatgcggcggtc
cgttctgcggtcagggtgggcatcactgagggccacactatgtttgcagttcatgatggc
tttgagggcttcagcaatggccagattaaagaaatcaagtggggggatgttggaggatgg
actggccagggagggtccctgctagggaccaaaagaactctcccagtgaaacacatggat
aaaattgctgaacagatgagaattcataacattaatgctctactggtcattggtggattt
gaggcatatctgggcctgctggagctgctagcagctcgcttcagacaccccgagctttgc
gttcccatggtgatgattcccgccaccgtctccaacaacatccctggctcagacctgagc
attggggcagacactgccctcaacgctatcactgcgacatgtgatcgaataaagcagtct
gcgagcgggacaaagaggcgtgtgtttattatcgagaccatgggtggctactgtggttac
ttggcaacggtgggggcgttggcagccggagctgatgccgcctacatctacgaggaaccc
ttcgatatccgagacctgcagtgcaatgtagagcatttgacagagaagatgaagacgagc
atccagcgaggcctagtgctcagaaacgagtgctgcaatgacaatttcactacagacttc
atctaccagctgtactcagaagagggcaaaggagtgtttgactgcaggaaaaatgtccta
ggacacatgcagcagggtggagctccatctccgtttgaccggaactatggcacaaagatt
gcagctaaagctatgcagtggatctcaaaaaaactgaaggagttctatgtagaaggtaaa
ggtcgtgtttttgctaacactgaggactctgcgtgtctgctgggaatgcgtcgtagagct
ctggtctttcaacctgtgacacaactaaaagacgagacagactttgtgcaccgcatccct
aaggagcagtggtggctgaagctccgccctctcatgaagatcctggccaaatacaagacc
agctatgatgtgtctgatgccggccagctagaacacgtcgctgggctgaggaccatagaa
gaaaatgggagagagaaggagggggaggaagagtga

DBGET integrated database retrieval system