KEGG   Electrophorus electricus (electric eel): 113591557Help
Entry
113591557         CDS       T05787                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eee01001]
    113591557 (mapk6)
Enzymes [BR:eee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113591557 (mapk6)
Protein kinases [BR:eee01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113591557 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 113591557
NCBI-ProteinID: XP_026887896
LinkDB All DBs
Position
Unknown
AA seq 723 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYTDLKPLGCGGNGLVFSAVDMDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPCGRHLAEDVGSLTEFNSVYIVQEYMETDLCKVLE
QGLLSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVIHEEDRQELQSVIPVFIKNDMSVPHTPLAKLLPGVSAGALDFLEKILTFN
PMDRLTAEEALAHPYMSDYAFPLDEPVSAHPFHIEDEVDDILLMDESHSHVYNWDRYHDS
QQSELDWHPHSAAEVEDVQRDPRALSDVTDDEEAQVDPRKYADADSEKFLDEPLFDLPPE
WSWPPHDHHHENKYCELECSPTCNYKAVSPSYLDNLIWRESEVNHYYEPKLIIDLSNWKE
QQNKEKGDRKSKSKCERNGLVKAQIALREAGHHGHSPSPPEKDRQQEKHQSFDFDSFIAG
TIKLSLQPEPGDVGLLNERNTSVSQLSKSVSQEKDEKCQVNLAQQSVRQPCPWDRLPGPG
ADDYCLIDEACRNAPKEGGGGGGGYVSYLDRLFSKQEETPVDTPPDTPSDTEESASPVQA
DTTGGFCARNGEIVLESLAIAGFDTATDLPLKSLQASLSPAAHVKCSPQIAHKTYSSIFK
HLN
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagtttgaaagccttatgaatattcatggctttgatttgggcccacgctat
acggacctgaagccgctgggctgcggtggcaacggccttgtattttccgctgtggacatg
gactgtgacaagcgcgtggctgtgaagaagatcgtgctgacagatccgcagagtgtcaag
cacgcgctgcgtgagatcaagatcatccggcgcctggaccacgacaacatagtgaaggtg
tttgagacgctggggccgtgcggccggcacctggccgaggacgtgggctcgctcaccgag
ttcaactcggtctatattgtgcaggagtacatggagacggacctgtgcaaggtgctggag
cagggcctgctgtctgagggccatgcccgtctgttcatgtatcagctgctacgtggcctc
aaatacatccactcggccaacgtcctgcaccgtgacctcaagcctgccaacctctttgtc
aacacggaagacctggtgctgaagatcggagacttcggcttggcccgcatcatggaccca
cactactcgcacaagggtcacctgtcggagggtcttgtcaccaagtggtatcgttcccca
cgtctcctcctctcccccaataactacactaaagccatcgacatgtgggcggctggctgc
atctttgccgagatgctcacagggaaaacgctcttcgcaggagctcatgagttggagcaa
atgcagttgatcttggagtcaattcctgtcatccatgaagaggacaggcaggagctccag
agcgtcattcccgtctttatcaaaaacgacatgtctgtaccccacacgccactcgccaag
cttctgccaggggtcagtgcgggagctctagatttcctggaaaagattctgacctttaac
cccatggaccggctgacagcagaggaagccctggcccacccctacatgagcgactacgcg
ttcccactggacgagcctgtctctgctcatcccttccacattgaggacgaggtggatgac
atcctcctcatggacgagagccacagccatgtctacaactgggacaggtaccacgacagc
cagcagtctgagctcgactggcacccgcacagtgcggcagaggttgaggatgtgcagcgc
gacccacgggccctctctgatgtcacagatgacgaggaggctcaggtggacccacgcaaa
tacgccgatgctgacagcgagaagttcttggacgagccactgtttgacctgccgccagag
tggtcgtggccaccgcacgaccatcaccacgagaacaagtactgtgagctggagtgtagc
cccacctgcaactacaaggccgtgtcgccgtcctacctggacaacctgatctggcgcgag
agtgaagtgaaccactactacgagcccaagctcatcatcgacctgtccaactggaaggag
caacagaacaaggagaagggtgaccgcaagagcaagagcaagtgcgagagaaacggcctg
gtgaaggcgcagatcgccctgcgcgaggcaggccaccacggccatagccccagcccgcct
gagaaggatcggcagcaggagaagcaccagagcttcgacttcgactccttcattgccggc
accatcaagctcagcctgcagccggagcctggcgatgtgggcctcctgaatgagcgcaac
acctccgtgtcacagctgtccaagtctgtcagccaggagaaagatgagaaatgccaggtg
aacctggcccagcagagcgtgcgccagccatgcccgtgggaccgcctcccgggaccaggt
gccgacgactactgcctgatcgacgaggcctgcaggaacgcaccaaaggagggcggtgga
gggggcggcggctatgtcagctacctggaccgcctcttcagcaagcaggaagagacgcct
gtggacacgcctcccgacacaccttctgacaccgaagaatccgcctccccggtccaggcc
gacacaacaggcggcttctgtgctcggaatggcgagattgtgctagagtcgctggccatc
gcagggttcgacacagccaccgacctgccgctgaagtccctgcaggcctcactttcgccc
gccgcccatgtcaagtgctcgccgcagatcgcccacaaaacatacagcagtatctttaaa
cacctgaattaa

DBGET integrated database retrieval system