KEGG   Electrophorus electricus (electric eel): 113591635Help
Entry
113591635         CDS       T05787                                 

Definition
(RefSeq) pannexin-1-like isoform X1
  KO
K03443  pannexin 1
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:eee00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113591635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eee02000]
    113591635
Transporters [BR:eee02000]
 Other Transporters
  Pores ion channels [TC:1]
   113591635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Innexin Pannexin_like
Motif
Other DBs
NCBI-GeneID: 113591635
NCBI-ProteinID: XP_026888016
LinkDB All DBs
Position
Unknown
AA seq 428 aa AA seqDB search
MAIAHVATEYVFSDFLLKEPNESVYKGVRLELAADKLVTFIAVGLPLLLISLAFAQEVSV
GTQISCFPPSNFTLRQAAYTDSFCWVAVEGQTTEDGSPLWLHKFFPYVLLLLAVLMYTPV
LFWRFTAAPQLSSDLGFIMEELDRCYNRAIRQAKSLASPPRSARDVPEDSHSGLELAESC
FKPPLVEQYLWTKQSVWTLALKYLLCRALTLLTLLLACLYLTYYICMVSPSDQFSCILHT
GALLNDSAPPVVQCKLVAVGVFRLLSCINVGVYLLLIPAVIYSALLPGRHRKEIRLLRPY
RLLPAFGHAQGLQLATHRYDDLSIYLLFLEENLSELKSYKCLQVLELLTEVESKTLDMSC
LLRTLGQVKTDLVDRKLPPTIDGNSQSAHEKQGTESAVFKDVSTQLLQDGPEKETQCSCR
KVVRQRVL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctatagcgcacgtcgcaacggagtatgtgttttccgattttttattaaaggaaccg
aatgaatcagtttataagggggtacgtttggaactggccgcggataaactcgtcactttt
attgcggtgggactccctctcttgctaatttctctagcctttgcccaagaagtgtcagtg
ggtacccagatcagctgtttcccacccagtaacttcaccctgcgacaggctgcatacaca
gactccttctgctgggtcgctgtggagggtcaaactacagaggatggctctcccctgtgg
cttcataagttcttcccctacgtgctcctcttgctggctgtgctcatgtacactcctgtt
ctcttctggcgcttcaccgctgcgccccaactctcctctgacctcggcttcatcatggag
gagctggaccgctgctacaaccgtgccatccgccaggccaagagcctggcctccccccca
cgcagtgctagggatgtccccgaggactcccacagcggtctggagttggcggagagctgc
tttaagcctcctctagtggagcagtacctgtggaccaagcagagcgtttggacgctggca
ctgaagtacctgctgtgtcgagctctcactctgctcaccttactgctggcctgcctctac
ctgacctactacatctgcatggtgtcgcccagcgaccagttctcctgcatcctgcacaca
ggtgctctcctgaatgacagtgctccacctgtagtgcagtgtaagctggtggctgtgggc
gtgttccgcttgctcagctgcattaacgtgggtgtgtacttgctgttgatacctgctgtc
atatactctgccctgttgcctggacgtcaccgcaaggaaatccgtttgctccgcccatac
cgtctactgcccgcatttggccacgcccaagggttgcagttggctacccatcgctatgat
gacctgagtatctatctgctctttctggaggagaacctgagtgagctgaagagctacaag
tgtctgcaggtattagagttactgacagaggtagagagcaaaaccttggacatgtcatgt
ctcctgaggacacttggacaagtgaagactgatctggtggacagaaaactccctcccacc
atagatggcaatagccaatcagctcatgagaagcagggaacagaatctgctgtgttcaag
gatgtctccactcagctgctgcaggatggaccagagaaagagacccagtgcagctgtagg
aaggttgtgagacagagagtgttgtga

DBGET integrated database retrieval system