KEGG   Eubacterium eligens: EUBELI_00447Help
Entry
EUBELI_00447      CDS       T00908                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
eel  Eubacterium eligens
Pathway
eel00970  Aminoacyl-tRNA biosynthesis
eel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EUBELI_00447
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:eel03029]
    EUBELI_00447
Enzymes [BR:eel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EUBELI_00447
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EUBELI_00447
Mitochondrial biogenesis [BR:eel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EUBELI_00447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACR71463
UniProt: C4Z3J4
LinkDB All DBs
Position
456730..458175
Genome map
AA seq 481 aa AA seqDB search
MSLLDYTAVELAAKIKAGETTATEAMEAVIAQIEKSEDELNCYVTFDKEKALAAAKKADE
DIKAGKLTGPLAGVPFAIKDNMCTEGMLTTCSSKILGNFVPTYTADAVERLQNAGAVIIG
KTNMDEFAMGSTTETSAFGATKNPRNPEHVPGGSSGGSAAAVAANECFAALGSDTGGSIR
QPASYCGVVGLKPTYGTVSRYGLIAYGSSLDQIGPLCKDVTDCATIMEAIAGKDDKDSTS
IGRDDYSFTNALVDDVKGMKIGIPRDYFGEGLDPEVKEAVLNAAKVLESKGAIVEEFDLS
LVEYAIPTYYTIAAAEASSNLERFDGVKYGYRTKEYEGLHNMYKKTRSEGFGPEVKRRIM
LGSFVLSSGYYDAYYLKALRVKALIKKAFDEAFAKYDVILGPVAPTTAPKLGSSLSDPIK
MYLGDIYTISVNLAGLPGLSVPCGKDKNGLPIGLQLIGDCFKENNIIRAGYAYEQARGRF
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagtttattagattatacagctgttgaactggctgctaagattaaagcgggtgagaca
acagcaacagaggctatggaagctgttattgcacagattgaaaaatctgaagatgagctt
aactgttatgtcacatttgacaaggaaaaggctcttgcagcagcaaagaaagcagatgag
gatatcaaggcaggtaagcttacaggacctttagccggagtaccatttgcaatcaaagat
aatatgtgtacagagggcatgcttactacatgctcatcaaagatacttggtaatttcgtt
ccaacttacacagcagacgctgtagaaagacttcagaatgcaggagctgtaattatcgga
aagactaacatggatgaattcgcgatgggttctacaactgagacaagtgcatttggtgca
actaagaatccacgcaatcctgagcatgtacctggtggttcatcaggtggttcagcagca
gcagtagcagctaatgagtgttttgcagcacttggttctgatacaggtggatcaataaga
cagccagcttcttactgtggtgttgtaggcttaaagccaacttatggaacagtttcacgt
tacggacttatcgcttatggttcatcattagaccagattggacctttatgtaaggatgta
actgactgtgcaactatcatggaagctatcgcaggcaaggacgataaggattcaacatct
atcggaagggatgattattcatttacaaatgcattagttgatgatgttaagggaatgaaa
atcggtattccaagagattattttggagaaggtcttgacccagaggttaaggaagctgtt
cttaacgctgccaaagttcttgagagcaagggcgcaatcgttgaagagtttgatttaagc
cttgttgagtacgcaattcctacttattatacaatcgcagcagcagaagcaagctctaac
cttgaaagattcgatggtgttaaatatggatacagaactaaagaatacgaaggactccac
aacatgtacaagaagacacgttcagagggctttggaccagaggttaagagaagaattatg
ctcggttctttcgtattaagttcaggatattatgacgcttattatcttaaggcattaaga
gttaaggctcttattaagaaagcatttgatgaagcatttgcaaaatacgatgtaattctt
ggacctgttgcacctacaacagcaccaaagcttggttcatcactttctgaccctattaaa
atgtatcttggagatatctatactatttctgtaaatcttgccggacttccgggactttct
gttccatgcggtaaggacaagaatggtcttccaatcggcttacagcttattggcgactgc
tttaaagagaataatattatccgtgcgggctacgcttatgagcaggcacgaggaagattt
gaatag

DBGET integrated database retrieval system