KEGG   Elizabethkingia anophelis JM-87: BBD30_06565Help
Entry
BBD30_06565       CDS       T04743                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
een  Elizabethkingia anophelis JM-87
Brite
Enzymes [BR:een01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BBD30_06565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD Big_3_5
Motif
Other DBs
NCBI-ProteinID: AQW93882
UniProt: X5K1M6
LinkDB All DBs
Position
1421766..1422275
Genome map
AA seq 169 aa AA seqDB search
MKNLKILSLGILGAVFTVSCATKEVSYAITPKSGTATGGTVTFKQMGKNVVMNVDAKGLT
PGVHAIHIHDKPDCSAPDGTSTGGHWNPAGSDHGKWGAEHFHMGDIGNLNADDKGNAKLT
FKTSKWCIGCTDETKNILNHGLIIHAAADDFHTQPTGNAGGRVGCVEIK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaaaaatattatccttaggcattctgggagctgtatttacagtttcgtgt
gctactaaggaggtaagttatgctattacccctaaaagtggaacagcaacaggaggaacc
gtaacctttaaacagatgggcaaaaatgtagtcatgaatgttgatgcaaagggattaacg
ccaggagtacatgctattcacatccatgataagccagactgttcagctccagacggaaca
tctacgggtggacactggaaccctgcaggaagcgaccatggaaaatggggagcagaacat
ttccatatgggtgatataggtaaccttaatgctgacgacaagggtaatgcaaaattaact
tttaaaacaagcaaatggtgtattggttgtacagatgaaacaaagaatatcctgaatcac
ggattaatcattcatgcagctgctgacgatttccatactcagcctacgggaaatgcaggc
gggagagttggatgtgttgagattaaataa

DBGET integrated database retrieval system