KEGG   Enterococcus faecalis V583: EF0257
Entry
EF0257            CDS       T00123                                 

Gene name
mfd
Definition
(RefSeq) transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Organism
efa  Enterococcus faecalis V583
Pathway
efa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:efa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EF0257 (mfd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:efa03400]
    EF0257 (mfd)
Enzymes [BR:efa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     EF0257 (mfd)
DNA repair and recombination proteins [BR:efa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      EF0257 (mfd)
SSDB
Motif
Pfam: CarD_CdnL_TRCF UvrB_inter TRCF Helicase_C DEAD ResIII SNF2_N AAA_7 AAA_22 UB2H DUF1474 MCD_N
Other DBs
NCBI-GeneID: 1199148
NCBI-ProteinID: NP_814051
UniProt: Q839B9
LinkDB
Position
233149..236718
AA seq 1189 aa
MENSRKEGPCLNIIERISQTEIAKSWRSQLMTTGTRQLITGLSGSAKTLLMAGALQKTHQ
KIVIAVPNLYYANQLVDDFLNILPSEQVHLFPVDEVLSAEMAFSSPEARADRVSALNFLM
TANAGIVVVPVAGLRKYLPTKETWQNAQLYWEIGTEVEPEILAQRLVLMGYERQAMVGKP
GEFSIRGSIVDVYPLNAEYPVRVELFDVEIDSIRYFEADTQRSLENLEEVTISPMTDLVF
SKADMNHGMTRLQDALEKRLATAKDQTETDFLEEYFGQLLSSWEQGIPTENAHYYTDFLY
QQKTTLLDYLPENSLLFVDDYSRMMETEREIAREEAEWQTLKIEEMRVFSEQTFGVDFHD
QLRKTARNTTFFSLFQKGMGNLRFQEVHNFQYRSMQQFFGQMPLLKAEVDRWQKQNQTVV
VFVPTKERIQKVEELFQDFDIPSVVSNWDQLLDGHVQIVQGALQTGFELPKNKLVAITEK
EIFHTTTKKRARRQTISNAERLKSYSDLKTGDYVVHANHGIGKYIGMETLEVDGVHQDYM
TILYQNDDKLFIPVTQLNLIQKFVASESKTPKINKLGGSEWTKTKRKVASKIEDIADDLI
LLYATRESEKGYAFPPDDAYQKEFEEAFPYSETDDQLRSAAEIKHDMEKSRPMDRLLVGD
VGFGKTEVALRAAFKAVSNNKQVAFLVPTTILAQQHYETIQERFEGFPVEIGLLSRFRTK
KQQNETIEKIKHGQVDIVIGTHRLLSQDINFSDLGLLIIDEEQRFGVKHKERLKQLRSQV
DVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRYPIQTYVMENNPGAIREAIEREMARD
GQVFYLYNRVDTIERKVEELQALVPDARIAYAHGQMTEVQLENTLFDFIEGQYDILVTTT
IIETGVDIPNANTLFVENADYMGLSTLYQLRGRVGRSNRVAYAYFMYEQQKILNEVSEKR
LEAIKDFTELGSGFKIAMRDLSIRGAGNLLGAQQHGFIDSVGFDMYSQMLSEAVARKQGK
NIQDQKTSVEIDLGIDAYIPGTYITDERQKIEIYKRIRQLENMDMYEELEADLLDRFGEY
PDEVAHLLTTGRIKMDGDRALLESIRKRDQKVKFVLSKIGTKTYSVEQLFEALSATSLKA
DLAVEKEQMTISLKLPKDCKEAVWIQEIAAFTTALRQEKYKHSQGTDSL
NT seq 3570 nt   +upstreamnt  +downstreamnt
atggaaaatagcagaaaggagggcccttgtttgaatattatcgaacgaattagccaaaca
gaaattgctaaatcatggcgcagtcaactaatgacaacaggaacgcgccaactaattact
gggttatcaggctctgctaaaacattactgatggcaggcgctttacaaaagacgcatcaa
aaaattgttattgcggtcccaaacctatactatgccaatcaattagtagatgatttttta
aatattttaccttcagaacaagttcatctatttccagtagatgaagtgttatccgccgaa
atggccttttcttcaccagaagcgcgcgcagatcgagtgagtgcgttaaatttcctgatg
acagcgaatgcaggaatcgtggtcgtaccagtagctggactacgaaaatatttgccaacg
aaagaaacgtggcaaaatgcgcaactttattgggaaatcgggacagaagtagaacctgag
atcctcgcgcaacgcttagtgttaatgggctatgaacgccaagcaatggtcggaaagcct
ggcgaatttagtattcgcggaagcattgttgatgtctatccgctaaatgccgaataccct
gttcgggtggaactgtttgatgttgaaattgactcaatccgttattttgaagcagatacc
caacgttcattagaaaatcttgaagaagtaacgatttcaccaatgactgatttagtattc
tcaaaggcagatatgaatcatggcatgacgaggttacaagatgctctagaaaaacgttta
gcgacagctaaagatcaaacggagaccgattttttagaagaatattttggtcagttgctg
tcttcttgggaacaagggattcctacagaaaatgctcactattatacagattttctgtac
caacaaaaaactacgctgttagattatttaccagaaaatagtttgctttttgtggatgat
tattctcgtatgatggaaacggagcgagaaatcgctagagaggaagcggaatggcaaacc
ctgaaaattgaagaaatgcgcgtgttttctgaacaaacttttggcgtagactttcatgat
caattgcgaaaaactgcacgaaatacgaccttcttttcactttttcaaaaaggaatgggg
aatcttcgtttccaagaagtccataatttccaatatcgttcaatgcaacaattcttcggt
caaatgccgttgctaaaagcggaagtggaccgttggcaaaagcaaaaccaaacggtcgtt
gtttttgttcctacgaaagaacggattcaaaaagtcgaagagctatttcaggactttgac
atacctagcgtagtaagcaattgggatcagttgttagatgggcatgtccaaattgtccaa
ggggcattacaaacagggtttgaattgcctaaaaacaagctcgtggcgattacggaaaaa
gaaatttttcatacaacgaccaaaaaacgggcacgtcgtcaaacaatctctaatgcggaa
cgtttgaaaagttatagcgacttaaaaacgggcgattatgtcgttcatgcgaatcacggg
attggtaaatatattggtatggaaaccttagaagttgatggggtccatcaagattacatg
actatcttgtaccaaaatgatgacaagttatttattccagtaacacaattgaacttgatt
caaaagttcgttgcttccgagtctaaaacgccgaaaattaacaagctaggcggcagtgaa
tggacgaaaactaaacgaaaagttgcttcgaaaattgaagatatcgcggatgatttaatc
ttactttatgcgacaagagagtcggaaaaaggctatgcttttccgccagatgatgcgtat
caaaaagaatttgaagaggcttttccgtattctgaaacagatgatcaattacgtagtgcc
gccgaaattaaacacgacatggaaaaatctcgaccaatggatcgtttgttagttggcgat
gtagggtttggtaaaacagaagtggctttacgagcggctttcaaagctgttagcaacaat
aaacaggttgcctttttagtgccaacaactattttagcgcaacaacattatgaaacgatt
caagagcggtttgagggctttcctgtagaaattggtttattaagtcgtttccgcacgaaa
aaacagcaaaatgaaacaattgaaaaaattaaacatggccaagtagatattgtgattggt
acccatcgtttattgtcgcaagatattaattttagtgatttaggcttgttgattattgat
gaggaacaacggtttggagtgaaacataaagaacgactaaaacaattgcgttcacaagtg
gatgtcttgacgttaacagcaacgccaatcccaaggacccttcatatgtcgatgttaggt
gtccgtgatttatccgtcatcgaaaccccaccagagaatcgttatccgatccaaacgtat
gtcatggaaaataatcctggggcgattcgggaagcgattgagcgagaaatggcccgagat
ggtcaagtcttttatttatacaatcgagtagatacgattgaacgaaaagttgaagagtta
caagcactagttccagatgcacgaattgcgtatgcacatgggcaaatgacagaagtacaa
ctggagaatactttgtttgattttattgaaggacaatatgatatattagtcactacaaca
attattgaaacaggagtagatattcctaatgctaataccttgtttgtagaaaatgcggac
tacatgggcttatctacgttgtatcaattacgtggtcgtgtggggcgtagcaatcgagtg
gcctatgcttattttatgtacgaacagcaaaaaatcctaaacgaagttagtgagaaacgt
ttagaagcaattaaagactttacggaattaggttctgggttcaaaattgcgatgcgtgac
ctttccattcgaggggccgggaaccttcttggtgcccaacaacacggcttcattgattcg
gttgggtttgatatgtactcgcagatgttatctgaggcagttgctcgtaaacaaggaaaa
aatatccaagaccaaaaaacgtctgttgaaattgatttgggcattgatgcttatattcca
ggaacgtacattacagacgaacgacaaaaaattgaaatttataaacggattcgtcaatta
gaaaatatggatatgtacgaagaattagaagcggacttgttagaccgctttggagagtat
cctgacgaagtggcgcatttattaaccactggccgtatcaaaatggatggcgaccgtgcc
ttgttagaaagtattcgtaaacgcgatcaaaaagtcaagtttgtgttaagtaaaattggc
acaaaaacatactctgtggagcagttgtttgaagcgttatcggcaaccagcttaaaagcg
gatctagcagttgagaaagaacaaatgactatttccttgaagttgccgaaagattgtaaa
gaagctgtttggattcaagaaattgctgcttttacaaccgcattgcgacaagaaaaatac
aaacattcgcaaggaacggattccctttaa

DBGET integrated database retrieval system