KEGG   Enterococcus faecalis V583: EF0721
Entry
EF0721            CDS       T00123                                 

Gene name
pcrA
Definition
(RefSeq) ATP-dependent DNA helicase PcrA
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
efa  Enterococcus faecalis V583
Pathway
efa03420  Nucleotide excision repair
efa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:efa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EF0721 (pcrA)
   03430 Mismatch repair
    EF0721 (pcrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:efa03400]
    EF0721 (pcrA)
Enzymes [BR:efa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EF0721 (pcrA)
DNA repair and recombination proteins [BR:efa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EF0721 (pcrA)
   MMR (mismatch excision repair)
    Other MMR factors
     EF0721 (pcrA)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 Exonuc_V_gamma DUF3553 AAA_11 ResIII Terminase_6 DEAD
Other DBs
NCBI-GeneID: 1199620
NCBI-ProteinID: NP_814471
UniProt: Q837V7
LinkDB
Position
676773..679031
AA seq 752 aa
MTQKHALVQGMNPRQEEAVLHTEGPLLVMAGAGSGKTRVLTHRIAYLIEEKEVNPWNILA
ITFTNKAAKEMKERVNKLLETGGEDVWVSTFHSMCVRILRRDVDQIGYNRNFTIIDPSEQ
KTLMKRILNDLNIDSKKYDPRSILGTISNAKNELQTPEKVAEMQGSLYEEIVAKCYEAYQ
KELRKNQCMDFDDLIMNTIRLFNEQPDTLAFYQNKFHYIHVDEYQDTNHAQYTLVNLLAA
RFKNLCVVGDADQSIYGWRGADMQNILDFEKDYPDASVILLEQNYRSTKNILAAANDVIK
NNRNRREKELWTENIDGEKIVYYRGDTERDETQFIVSQIQKEMRENDRIYGDFAVLYRTN
AQSRVVEEMLLKSNIPYTMVGGHKFYDRKEIKDILAYLSLIANPDDSISFERIVNEPKRG
IGKSSIEKLRLFADTHGWALLEAAQNVDLANISGKAGKELGNFGMMIQDLTKTVPYLTIT
ELVKETLQRSGYREALMAQNNLESQARLENLDEFLSVTQEFDKRFEAQNNDDPNGEETKL
ADFLTDLALVSDLDNLEESSSQVTLMTLHAAKGLEFPVVFLMGLEEGVFPLSRAMLEESE
LEEERRLAYVGITRAEEALFLTNAYSRTLYGRTQYNRPSRFLEEIEAERLMKQGAAANLQ
KAPARTFDPKVFKPSASKPAYTQPATKSVSNKVASGGEKVSWQAGDKVQHKAWGVGTVVR
VGGSAKDLELDIAFPEKGIKRLLAAFAPIEKI
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgacacaaaaacatgccttggttcagggaatgaatcctcgacaagaagaagccgttttg
catacagaaggaccactgttagtcatggctggtgctggtagtggaaaaacgcgggtttta
acacaccgaattgcctatctaattgaggaaaaagaagtaaatccatggaatattttggcg
attacgtttaccaataaagctgctaaagaaatgaaagagcgtgtaaataaattactggaa
acgggtggcgaagatgtatgggtctccacttttcactccatgtgtgtaagaattttacgt
cgtgatgtggatcagattggttacaaccgtaattttacaattattgacccatcggaacaa
aaaacattaatgaaacgcatcttaaacgacttaaatattgattcaaaaaaatatgatcct
cgctcaattttaggtacgattagcaatgccaaaaatgaattacaaacgcctgaaaaagtt
gctgaaatgcaaggttccttatatgaagaaattgtcgcaaaatgctatgaagcctatcaa
aaagaattgcgcaaaaaccaatgtatggattttgatgatttgattatgaatacgattcgt
ttatttaatgaacaaccagatacgttggctttctaccaaaataaatttcactatattcat
gtggatgaataccaagataccaatcatgcacaatataccttagtcaatttattggctgca
cgtttcaaaaatctgtgtgtcgtaggtgatgccgaccaaagtatctatggttggcgcggg
gcggatatgcaaaatatcttggattttgaaaaagattatccagatgccagtgtaattttg
ctagaacaaaattatcgatccaccaaaaacattttggcggctgcgaatgatgtcatcaaa
aataaccgtaaccgccgcgagaaagaactgtggacagaaaatatagacggtgaaaaaatt
gtctattatcgcggggacacagaacgggatgaaacacaatttattgtgagccaaatccaa
aaagaaatgcgggaaaatgaccgaatttatggtgattttgcggtattatatcggaccaat
gctcaatcccgtgtagtggaagaaatgctcttgaaatctaatattccgtataccatggtg
ggcggacataaattctacgaccgtaaagaaattaaagatattttggcttatttaagtttg
attgccaatccagatgattcgattagttttgaacgaattgtcaatgaaccaaaacgagga
atcggtaaaagttcaattgaaaaattacggctatttgcggatacgcatggttgggctttg
ctggaagctgcccaaaatgttgatttggcaaatatttcaggaaaagcgggtaaagagctt
ggtaattttggcatgatgattcaagacttaacgaaaacagtgccctatttaacgattaca
gaattggtgaaagaaactttacaacgtagtggttatcgggaagctttgatggcgcaaaat
aatttagagtctcaagctcgcttagaaaacttggacgaatttttatctgtgacacaagaa
tttgataaacgttttgaagcgcaaaacaacgacgatccaaatggcgaagaaacaaaattg
gcggatttcttaacagatttagccttggtttctgatttagataatttagaagagagctct
tcgcaggtaaccttaatgacgttgcatgcggccaaagggctggaatttccagtggtcttt
ttaatgggcttagaagaaggggttttcccattatcacgtgccatgctagaagaaagtgaa
ctggaagaagaacggcgcttggcttatgttggtatcacacgagcggaagaagccttgttc
ttaacgaatgcttattcgagaacattatatggtcgcacgcaatataatcgaccaagtcgc
tttttagaagaaattgaggcggagcgtttaatgaaacaaggggcggcagccaatttacag
aaagctccagcgcgcacctttgatcctaaagtatttaagcccagcgcaagtaaaccagct
tatacacaaccagctacaaaatcagttagcaacaaagtggcaagtggtggcgaaaaagtt
tcttggcaagcaggtgataaggtccaacataaagcatggggcgttggtacagtcgttcgt
gtaggcggttcggccaaagacttagagttggacattgctttcccagaaaaaggcattaaa
cggttgttagcggcatttgcaccaattgaaaaaatttaa

DBGET integrated database retrieval system