KEGG   Enterococcus faecalis V583: EF0763
Entry
EF0763            CDS       T00123                                 

Gene name
uvrA
Definition
(RefSeq) excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
efa  Enterococcus faecalis V583
Pathway
efa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:efa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EF0763 (uvrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:efa03400]
    EF0763 (uvrA)
DNA repair and recombination proteins [BR:efa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EF0763 (uvrA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      EF0763 (uvrA)
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_16 AAA_29 RsgA_GTPase AAA_22 AAA_33 AAA_14 AAA_23 MMR_HSR1 AAA_18 APS_kinase ATPase DUF2075 AAA_24 NACHT DnaJ_CXXCXGXG Viral_helicase1 cobW ATPase_2 NB-ARC BCA_ABC_TP_C T2SSE RNA_helicase MeaB DUF87 NTPase_1 PRK Septin DAP3 Rad17
Other DBs
NCBI-GeneID: 1199659
NCBI-ProteinID: NP_814510
UniProt: Q837R8
LinkDB
Position
721603..724422
AA seq 939 aa
MANDKIVIHGARAHNLKNIDVTIPRDKMVVVTGLSGSGKSSLAFDTLYAEGQRRYVESLS
AYARQFLGQMDKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTVTEINDYLRLLFARVGHP
ICPNDHIEITSQSVEQMVDKVLELPERTKIQILAPVVVKKKGQHKKVFEMIQREGYVRMR
VDGETYDVSEAPELEKNKKHDIAIVIDRIVVKEGIRSRLFDSFEAALRLAEGYAIVDVIG
QEEMLFSEHYACPYCGFTVGELEPRLFSFNAPFGACPDCDGLGVKLEVDKDLVIPDPTKT
LREGAIVPWNPISSQYYPQMLEQAATSFGIDMDTPFEELPADQQEIILNGSGEKNFHFHY
ENDFGGVRDVEVPFEGILKNIKRRYHETNSDFTRDQMRLYMTELTCRSCQGYRLNPQALA
VKINGTHIGEVSELAIKNAVQFFEGVSLSEQETTIARPILKEVEDRLTFLKNVGLDYLTL
SRAAGTLSGGEAQRIRLATQIGSNLSGVLYILDEPSIGLHQRDNDRLIDSLKKMRDLGNT
LIVVEHDEDTMMASDYLIDVGPGAGHLGGEIVAAGTPEEVAKNPHSLTGQYLSGKKVIPV
PKERRKGNGKAIKVTGASENNLKNVSVEFPLGEFVAVTGVSGSGKSTLVNQILKKALAQK
LNRNSNKPGKHKSITGYEAIEKIVDIDQSPIGRTPRSNPATYTSVFDDIRDLFAQTNEAK
VRGYKKGRFSFNVKGGRCEACRGDGIIKIEMHFLPDVYVPCEVCHGKRYNSETLEVHYKG
KNISDILDMTVEDAVEFFKHIPKIHRKLQTIVDVGLGYVTLGQPATTLSGGEAQRMKLAS
ELHKNSNGKNFYILDEPTTGLHTDDIARLLLVLERLVEAGNTVLVIEHNLDVIKSADHVI
DLGPEGGDGGGTIVATGTPEEVAKVKDSYTGYYLKRVLK
NT seq 2820 nt   +upstreamnt  +downstreamnt
atggcaaatgataaaattgtgattcatggtgcacgcgcccataacttaaaaaatattgat
gtcacgattcctcgtgacaaaatggttgtcgtaactggactatctggttctggcaaaagt
tcattagcgtttgatacgctttacgcagaagggcaacgacgttatgtagagagtctctct
gcttatgcgcgacaatttttgggacagatggataaaccagatgttgacagcatcgatggt
ttaagtccagctatttcaattgatcaaaagacgacaagtaaaaacccacgctcaacggtg
gggacggtcacagaaatcaatgattatttacgattgttatttgctcgggtaggtcatcca
atttgtcctaacgatcatattgaaattaccagtcagtctgttgaacagatggttgataaa
gtcttagagctaccagagcgaacaaaaattcaaattttggcccctgttgtggtcaagaaa
aaaggccaacataaaaaagtgtttgaaatgatccaacgtgaagggtatgtcagaatgcgg
gtggatggtgaaacctatgatgttagtgaggcaccagaacttgaaaaaaataaaaaacat
gatattgcgattgtgattgaccgtatcgttgtgaaagaaggcattcgctctcgcttgttt
gattcgtttgaagcggctttgcgtttagctgaaggttacgcaattgttgatgtgattggt
caagaagaaatgttgtttagtgaacattatgcttgtccttattgtgggttcacagtcggt
gaattggaaccgcgcttgttttcatttaatgcaccatttggcgcttgtcccgattgtgat
ggtttaggtgttaaattagaagtggacaaagacttagtgattccagatcccactaaaacc
ttgagagaaggggccattgttccgtggaaccctattagttcccaatattatccacaaatg
ttggagcaagcagccaccagttttgggattgatatggatacgccgtttgaagaattacct
gcagaccaacaagaaattattttaaatggttctggcgagaaaaactttcattttcattat
gaaaatgactttggtggtgttcgtgatgtggaagtgccatttgaagggattttaaaaaat
attaaacgacgttatcatgaaacgaatagcgattttacacgagatcaaatgcggttatac
atgacagaattgacttgtcgaagctgtcaagggtatcgtttgaatccgcaagctttagct
gtaaaaatcaatggcacgcacattggtgaagtcagtgaattagcaataaaaaatgcggtc
caattttttgaaggtgtgtctttatctgaacaagaaacaacgattgctcggccaatttta
aaagaagtcgaagatcggttaaccttcttaaaaaatgttgggttagattacttaacctta
agtcgagctgctggtacactttctggcggagaagcacaaagaattcgcttagcaacacaa
attggatcaaacttatcaggcgttctttacattttagatgaaccatcaattggtttgcat
caacgagataacgaccgcttgattgactcattgaaaaaaatgcgggacttaggcaataca
ttaattgtggtggaacatgatgaagatacaatgatggcttcggattacttgattgatgtg
ggacctggcgctggacatctgggcggtgaaattgtagccgctggtacgccggaagaggtt
gctaaaaatccgcattcattgaccgggcaatatctttctgggaaaaaagtgattcctgta
ccaaaagaacgtcgcaaaggtaatggcaaagcgatcaaagtcactggtgccagtgaaaat
aatttaaaaaatgtcagtgttgaatttccgctgggtgaatttgttgctgtcacaggcgtt
tcaggttcagggaaaagtactttagtcaatcaaattttaaaaaaagcgctggcccaaaaa
ttaaatcgtaattccaataaacccgggaaacacaaaagcatcactggttatgaagccatt
gaaaagattgttgacattgaccaaagtccaattggtcgaacaccaagaagtaatccagcg
acttatactagtgtttttgatgacattcgcgatttgtttgcccaaacaaatgaagccaag
gttcgtggctataaaaaaggtcgctttagttttaacgtcaaaggtggccgttgtgaagct
tgtcgcggggatggtatcatcaaaattgaaatgcactttttacctgatgtctatgtgcct
tgcgaagtttgtcatggcaaacgttataattctgagacgttagaagttcattataaaggc
aaaaacatttctgatattttagatatgacggtggaagatgccgtagaatttttcaaacat
attcctaaaattcatcgtaaattgcaaacaattgtggatgtaggcttaggctatgtgaca
ttggggcagccggcaactactttatctggtggggaagcacagcggatgaagctagcgagt
gaacttcataaaaattctaatgggaaaaacttttatattctggatgaaccaacaacaggc
ttgcataccgatgatattgcgcgattgcttctagtattagagcgtttagtggaagcgggc
aataccgttttagtgattgaacataacttggatgtcatcaagtctgcggatcatgtgatt
gatctagggccagaaggtggcgacggtggtgggacgatcgtggcgaccggaacaccagaa
gaagttgctaaagtcaaagacagttacacaggatattatttaaaacgtgttctgaaataa

DBGET integrated database retrieval system