KEGG   Enterococcus faecalis V583: EF0994
Entry
EF0994            CDS       T00123                                 

Gene name
murG
Definition
(RefSeq) UDPdiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00550  Peptidoglycan biosynthesis
efa01100  Metabolic pathways
efa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:efa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EF0994 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EF0994 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:efa01011]
    EF0994 (murG)
Enzymes [BR:efa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     EF0994 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:efa01011]
 Precursor biosynthesis
  Glycosyltransferase
   EF0994 (murG)
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_transf_4 UDPGT Glyco_trans_4_2 CmcI Glyco_trans_4_4
Other DBs
NCBI-GeneID: 1199882
NCBI-ProteinID: NP_814730
UniProt: O07109
LinkDB
Position
951746..952837
AA seq 363 aa
MKILVTGGGTGGHIYPALSFVEHVKKEAPATEFLYVGTENGLESQIVPKAKIPFKTIKIQ
GFKRSLSPQNFKTIYLFLTSINKAKKIIREFQPDVVIGTGGYVSGAVVYAAHQLKIPTII
HEQNSIPGMTNKFLSRYVDKIAICFPDVASFFPKEKTILTGNPRGQEVVTVEKSAILSEF
GLDPAKKTVVLFGGSRGALKINQAFEQAFPLFEEREYQVLYASGERYYQELQESLKFSEK
KLTNISVQPYIDKMVEVMANTDLMVGRAGATSIAEFTALGLPAILIPSPYVTNDHQTKNA
QSLVKVGAVEMIPDAELTGARLVAAIDDILLNNEKRQQMATASKGEGIPDASDRLYQVVK
TLV
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaagatactagtaactggtggtggcacaggtgggcatatctatcctgcgttatccttc
gtcgaacacgtcaaaaaagaagcacctgcaacagaattcttgtatgtgggaacagaaaat
ggtctagaaagtcaaattgtgccaaaggcgaaaattccatttaaaacgattaaaattcaa
ggattcaagcgttcgctaagtcctcaaaattttaaaacaatttatttatttttaacaagc
attaataaagcaaaaaaaattattcgtgaatttcaaccagatgtggtcattggtacaggc
ggttatgtttctggtgcagtggtttatgcggcccaccaattaaaaataccgacaattatt
catgaacaaaatagtatccccggaatgacaaataaatttttaagtcgttatgtggataaa
attgcgatttgttttccggatgtcgctagttttttcccgaaagaaaaaacaattttaaca
gggaacccgcggggacaagaagtcgtaacggtggaaaagtcagctattttatcagagttt
ggcttggatccagcaaagaaaacggtggttttatttggcggaagtcgtggcgccttgaaa
atcaatcaagcgtttgaacaggcctttcctttgtttgaagagagagagtatcaagtttta
tacgcttcaggagaaagatattatcaggaacttcaagaaagtctaaagttttctgaaaag
aaattgacaaacataagtgtgcaaccgtatattgataaaatggttgaagtgatggctaat
accgatttaatggtgggacgtgcaggagcaacctcaattgcggagttcaccgcattagga
ttaccagcaattttaattccgagtccttacgtcacgaatgatcatcaaacgaaaaacgcg
caaagcttagtaaaagttggtgctgttgaaatgattccagatgcagaattgaccggcgct
cgtttagttgcggcaatagatgatattttattaaacaatgaaaaaagacaacagatggca
acggcgtccaaaggggaaggcatcccagatgcaagtgatcgtttgtatcaagttgtgaaa
acgttagtctga

DBGET integrated database retrieval system