KEGG   Enterococcus faecalis V583: EF1494Help
Entry
EF1494            CDS       T00123                                 

Definition
(RefSeq) V-type ATP synthase subunit K
  KO
K02124  V/A-type H+/Na+-transporting ATPase subunit K
Organism
efa  Enterococcus faecalis V583
Pathway
efa00190  Oxidative phosphorylation
efa01100  Metabolic pathways
Module
efa_M00159  V/A-type ATPase, prokaryotes
Brite
KEGG Orthology (KO) [BR:efa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EF1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_C
Motif
Other DBs
NCBI-GeneID: 1200397
NCBI-ProteinID: NP_815215
UniProt: Q834Y3
LinkDB All DBs
Position
1449797..1450270
Genome map
AA seq 157 aa AA seqDB search
MMDYLINNNGGIVFAVLGMAMATIFAGIGSAKGVGFTGEAAAALTTEQPEKFGQALILQL
LPGTQGLYGFVIAFLIYINLGNDMSMVQGLNYFVAALPIAFAGLFSGIAQGRVAAAGIQI
LAKKPEHATKGIIYAAMVETYAILGFVISFLLVLNVK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgatggattacttaattaataataatggtggaattgtttttgcagtattaggaatggca
atggcgacaatttttgctgggattggatcagccaaaggggttggctttactggggaagca
gcagcagctttaacgacggagcagccagaaaaatttggtcaagcgttaattttacagtta
ttaccaggtacacaaggactatatggttttgttattgctttcttaatttatattaactta
ggaaacgatatgagtatggttcaaggattgaactattttgtagcagctttaccaattgct
tttgcaggattgttctctgggattgcccaaggtcgtgtagccgctgcggggatccaaatt
ttagcgaagaaaccagaacatgcaacaaaaggaattatctatgctgccatggttgaaact
tatgccatcttagggttcgtaatttccttcttacttgtattgaacgtcaaataa

DBGET integrated database retrieval system