KEGG   Enterococcus faecalis V583: EF1562Help
Entry
EF1562            CDS       T00123                                 

Definition
(RefSeq) 3-deoxy-7-phosphoheptulonate synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
efa01100  Metabolic pathways
efa01110  Biosynthesis of secondary metabolites
efa01130  Biosynthesis of antibiotics
efa01230  Biosynthesis of amino acids
Module
efa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:efa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EF1562
Enzymes [BR:efa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     EF1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD NeuB IGPS PGM_PMM_II
Motif
Other DBs
NCBI-GeneID: 1200462
NCBI-ProteinID: NP_815279
UniProt: H7C796
LinkDB All DBs
Position
1514319..1515344
Genome map
AA seq 341 aa AA seqDB search
MIVIMKENATEKQMKQVIDLVTGAGLTTQTSQDNGKTVIGLIGDTEKLVEAELTALEGVE
KSVRISLSYKLTSRLFHPENTVVDVNGVKIGDGSMTMMAGPCSIESLDQIRECARIAKAG
GATILRGGAFKPRTSPYAFQGLEEEGLKYIRQAADELDMQVITEVMDEANLELVAKYSDI
LQIGARNMQNFKLLQAVGKTGKPIGLKRGIAGTIDEWLNAAEYIAAQGNFNVIFIERGIR
TYETATRNTLDLSAVPLIKKLSHFPIIVDPSHGVGIWDLVPPMARAGVASGADGLIVEIH
PDPANAWSDGPQSLNEKTYLRMMKEVHIIEKAMKEINALED
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtaattatgaaagaaaatgcaaccgaaaagcaaatgaaacaagtcattgattta
gtaacaggtgcaggcttaactactcaaacaagtcaagataatggaaaaacagtgataggc
ttgattggtgatacagaaaaattagttgaagcagagttaacagcattagaaggcgtggag
aaaagtgtccgcatttcgttgtcttacaaactaacgagtcgtttatttcatccagagaat
acagtggttgatgtgaacggtgttaaaatcggtgacggcagtatgaccatgatggcgggc
ccttgttcaatcgaaagcttagatcagattcgcgaatgtgcgcgaattgctaaagctgga
ggtgcaacaattttacgaggtggtgcattcaaacctagaacgtcgccatacgctttccaa
ggactagaagaagaaggactaaaatacattcgccaagcggctgatgaattagatatgcaa
gtcattacagaagtgatggatgaagcgaatttagaacttgtcgcaaaatacagtgacatt
ttacaaatcggtgcgcgcaacatgcaaaatttcaagttattacaagcggttggtaaaact
ggaaaacctattggcttaaaacgcgggattgctggtacgattgatgaatggctaaacgca
gctgaatacattgctgcgcaaggaaatttcaatgtgatcttcattgaacgtgggattcgt
acgtacgaaaccgctacgcgcaatacacttgatttaagtgcggtgcctttaattaaaaaa
ttaagtcattttccaattattgttgatccgagtcatggtgttggtatctgggatttagta
ccgccaatggcccgagcaggtgttgcttcaggtgcggacggcttgattgtagaaattcat
ccagatccagcgaatgcgtggtcagatgggccacaatccttgaatgaaaaaacttaccta
cgtatgatgaaagaagttcatatcatcgaaaaagcaatgaaagaaattaatgctttagaa
gattag

DBGET integrated database retrieval system