KEGG   Enterococcus faecalis V583: EF2859
Entry
EF2859            CDS       T00123                                 

Definition
(RefSeq) 4-oxalocrotonate tautomerase
  KO
K01821  4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00362  Benzoate degradation
efa00622  Xylene degradation
efa01100  Metabolic pathways
efa01120  Microbial metabolism in diverse environments
efa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EF2859
   00622 Xylene degradation
    EF2859
Enzymes [BR:efa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     EF2859
SSDB
Motif
Pfam: Tautomerase Tautomerase_2 DUF1904 DUF1002
Other DBs
NCBI-GeneID: 1201708
NCBI-ProteinID: NP_816481
UniProt: Q830C9
LinkDB
Position
complement(2741820..2741999)
AA seq 59 aa
MPFVHVELIEGRTEEQLTNMVKDITEAVSKNAGAPKENIHVIVNELKKDRYAQGGEWKK
NT seq 180 nt   +upstreamnt  +downstreamnt
atgccatttgtacatgtagaattaattgaaggccgcacagaagaacagttaactaatatg
gtcaaagatattacagaagctgtgtcaaaaaacgctggtgcaccaaaagagaatatccat
gtgattgtcaatgaattgaaaaaagaccgctatgcacaaggcggcgaatggaaaaaataa

DBGET integrated database retrieval system