KEGG   Enterococcus faecalis V583: EF2978Help
Entry
EF2978            CDS       T00123                                 

Definition
(RefSeq) PTS system transporter subunit IIC
  KO
K17466  D-glucosaminate PTS system EIIC component
Organism
efa  Enterococcus faecalis V583
Pathway
efa00030  Pentose phosphate pathway
efa01120  Microbial metabolism in diverse environments
efa02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:efa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EF2978
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    EF2978
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:efa02000]
    EF2978
Transporters [BR:efa02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   D-Glucosaminate-specific II component
    EF2978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EII-Sor
Motif
Other DBs
NCBI-GeneID: 1201829
NCBI-ProteinID: NP_816595
UniProt: Q82ZS0
LinkDB All DBs
Position
complement(2851119..2851868)
Genome map
AA seq 249 aa AA seqDB search
MGVLGVSIIMGLYYWFARLRFGYTFSGMLSQPLGAALVAGLATGKLSEAMVVGAGIQLVY
LGVTSTPGGNVPSDPALASAIAIPIALGVGMNAEAAVALAVPFGVLGVFMDQLRRTINAT
WVHMADKYAEELNYGGIYRAAFVYPALAGFLIRFPLVFAANFFGQSVVNKVLEVIPAWLM
HGFEVMGGILPALGFALTIMVIGKKNLIPYFLIGFVAVVYFGAEVMAVAILGICIAFLVR
NKALSEEAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttttaggtgtttcaattattatgggactttattattggtttgcacgtttgcgt
tttgggtacacattttcaggcatgctgtctcagccattaggcgcagcgttggtggctggt
ttagcaacaggaaaacttagtgaagcaatggttgtgggggcggggattcaacttgtttat
ctcggagtcacctccacaccgggcggcaatgtgcctagtgatccggctttagcttcagca
atcgcgattccgattgctttaggtgtgggaatgaatgccgaggcggctgttgcactagct
gttccttttggtgtgttaggcgtctttatggatcaattacggcgcaccatcaatgcgacg
tgggtgcatatggctgataaatatgcggaagagttaaattatggggggatttaccgagct
gcgtttgtttatccagctttagcgggatttttaattcgctttccgttggtttttgcggcg
aacttttttggtcaatctgtggtgaataaagtcttagaagttatcccagcatggttgatg
cacggctttgaagtaatgggtggtattttaccagcgttaggcttcgccttaacaattatg
gtaattggcaagaaaaatttgattccttattttttaattggttttgttgcagtagtatat
tttggcgcagaagttatggccgtcgctattttaggaatctgtattgcctttttagttaga
aacaaggcattgagtgaggaggcagcataa

DBGET integrated database retrieval system