KEGG   Enterococcus faecium Aus0085: EFAU085_00987Help
Entry
EFAU085_00987     CDS       T02788                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
efau  Enterococcus faecium Aus0085
Brite
Enzymes [BR:efau01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EFAU085_00987 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HsbA
Motif
Other DBs
NCBI-ProteinID: AGS74942
LinkDB All DBs
Position
975578..976186
Genome map
AA seq 202 aa AA seqDB search
MTYTLPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNLNSAIEKYPELGEKTIEELLSD
MDAIPTDIKTAVRNNGGGHANHSFFWEIMAPNAGGEPTGEIKEAINEAFGDFSSFKEEFK
KAAAGRFGSGWAWLVMENGKLAITSTANQDSPLMEGKTPILGLDVWEHAYYLKYKNVRPD
YIAAFWNVINWDEVNKRFEAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacattaccagatctaccttatgcatatgacgcattggaaccttatattgac
gaagaaacgatgcatctgcatcatgataagcatcacaatacttatgtgacgaatttaaat
tcagcaattgagaaatacccagaattaggcgaaaaaacaatagaagaattattatctgat
atggacgctattccaacagatatcaagacagctgtacgtaacaatggtggcggacatgct
aaccattcatttttctgggaaatcatggcaccaaatgctggtggcgaacctacaggagaa
ataaaagaagcgattaatgaagcttttggtgatttttcttcttttaaagaagaattcaaa
aaagcagccgctggacgatttggttctggatgggcttggcttgtaatggaaaatggaaaa
ttagctattacctctactgcaaatcaagattctccattgatggaaggaaagacaccaatt
ctaggtttggacgtttgggaacatgcttattatttgaaatataaaaatgtccgaccagat
tatattgcagcattctggaatgttattaattgggatgaagtaaacaaacgtttcgaagca
gcaaaataa

DBGET integrated database retrieval system