KEGG   Enterococcus faecium Aus0004: EFAU004_00874Help
Entry
EFAU004_00874     CDS       T01772                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
efc  Enterococcus faecium Aus0004
Brite
KEGG Orthology (KO) [BR:efc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EFAU004_00874
Enzymes [BR:efc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EFAU004_00874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C FMO-like Thi4 K_oxygenase DAO FAD_binding_3 Thioredoxin_4 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AFC62959
LinkDB All DBs
Position
complement(884503..886032)
Genome map
AA seq 509 aa AA seqDB search
MLDKETKQNLEQYLALIESPIVFSVSLDNSENSQKLAEFTKEIAEMSPKISWEKRDSMRT
PSFSINPVGKESGIVFAGIPLGHEFSSFLLAMLQISGRAPKISESLSLKIKKITQTLHFD
SYVSLTCHNCPDVVQALNILAVLNPNITHTMIEGGMFQKEIDDKKIMAVPTVFLNGEEFS
SGRMTIEQIVEKITGPLIEEELFEKEPYDVLVIGGGPAASSAAIYAARKGIRTGLVADSF
GGQVVETLGIENMIGTSYTEGPKLMQQVESHVRSYPIDIMMNQQAVSLNKEQHFINIGLA
NGISLKAKTAIIATGAHWRSINVPGEKEFKNKGIAYCPHCDGPLFKGKEIAVIGGGNSGV
EAAIDLAGLAKHVYVLEFLPELKADQILQDKLVSLANVTVIKHAATKEISGTNQVESLSY
IDRRTMEMHTLAVSGVFILVGLLPNTDWLDRTIEMNPRNEIVTEKNGATNIPGVFAAGDC
TDSPYKQIIVSMGSGATAALGAFDYLMRT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttagacaaagaaactaaacaaaatctcgaacaatatttagcactgattgaatctcct
attgttttttctgttagtttggataatagtgaaaatagtcaaaaactagctgaatttacg
aaggaaatagcagaaatgtctcctaaaatctcttgggaaaaaagagattcgatgcgcaca
cctagtttttctatcaatccagttggcaaagaaagtggaatcgtttttgctggtatcccc
ctcggtcatgaattttcctcttttttactggctatgttacaaattagtggacgggcaccg
aaaatcagtgaatctttgagtcttaaaatcaaaaaaataacacaaacattgcattttgac
agttatgttagcttgacttgtcataattgccccgacgttgtacaggcattgaatatatta
gctgtattaaatccaaatattactcatacgatgattgaaggtgggatgttccaaaaagaa
atcgatgataaaaaaatcatggcagtgccaactgtgtttttaaatggagaagaatttagt
agcggacgcatgacgatcgaacaaattgttgaaaaaatcactggccctttgattgaagaa
gagttgtttgaaaaagaaccttatgatgtattagtgattggcggtggaccagcagctagt
agtgcagctatctatgcagcacgtaaaggaatccgtacaggacttgtcgctgattctttc
ggcggacaagtcgttgaaacactagggattgaaaatatgattggtacctcttacacagaa
ggtccaaaattgatgcagcaagtagaaagtcatgtgcgtagttaccctatcgacattatg
atgaatcaacaggccgtttccttaaataaagagcaacattttattaatattggcttagct
aacggtatatcacttaaagcaaaaaccgccatcatcgcgacaggtgcgcactggcgttct
atcaatgtaccaggcgaaaaagagtttaaaaataaaggaattgcttattgcccacactgt
gacggccctttatttaaaggaaaagagattgctgttatcggtggtggtaattctggtgtt
gaagcagcaatcgatttggctgggttagcaaaacatgtatatgttctagaattcttacca
gaattaaaagcagatcaaatcttacaggataaactagtctctcttgcgaatgtcactgtt
atcaaacatgcagcgacgaaagaaatcagcggtacgaatcaggtagaatctctctcctat
atcgatcgccgtacgatggagatgcatacactagctgtttcaggagtattcattctagtc
ggcttactccctaatacggattggctagatagaacgatcgaaatgaatccaagaaatgaa
atagtgaccgagaaaaatggcgcaacgaatatccccggcgttttcgcagctggtgattgt
acagatagtccatacaaacaaatcattgtttcaatgggttcaggagctactgcagcttta
ggagcattcgattatctgatgcgcacttga

DBGET integrated database retrieval system