KEGG   Enterococcus faecium Aus0004: EFAU004_02618Help
Entry
EFAU004_02618     CDS       T01772                                 

Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
efc  Enterococcus faecium Aus0004
Brite
KEGG Orthology (KO) [BR:efc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:efc01001]
    EFAU004_02618
Enzymes [BR:efc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EFAU004_02618
Protein kinases [BR:efc01001]
 Serine/threonine kinases: Other
  Bacterial family
   EFAU004_02618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Kdo Haspin_kinase RIO1 Seadorna_VP7 DUF4366 FTA2 Pox_ser-thr_kin
Motif
Other DBs
NCBI-ProteinID: AFC64698
LinkDB All DBs
Position
complement(2678873..2680942)
Genome map
AA seq 689 aa AA seqDB search
MIELGKKLNGRYQITGNIGSGGMANVFLAHDLILDRDVAVKVLRFDFQNDQTAIRRFQRE
ALAATELVHPNIVSVYDVGEEDNMQYLVMEYVKGMDLKRYIQTHYPVPYETAVNIMQQIL
SAISLAHNHQIIHRDLKPQNVLIDNEGVVKITDFGIAIALSETSITQTNTMLGSVHYLSP
EQARGSMATKQSDIYALGIILYEMLTGSVPFDGESAVTIALKHFQDDLPSIKALDPNVPQ
ALENVILRATAKEPADRYKSAEEMSDDLSTVLSPARANEEKWQPHVMDNETKVITPLTED
APMPDSFKSMPLPKDKPENETLPEEEEVLPDPKKKGQKKWWLILLAILAVLGIGTAVFFA
SGGRGEVVVPDVSDLSEASARETLAKAKLEVATKTEEIADDKIEEGNVVKTDPAAGTTVK
QKREVTLYISSGTKKIKLDDYSGKSYEDAEASLKELGFSADLIQKEEEFSSEVESGMIIS
QSPSEDTEVDPKTDTITFTVSKGPETVTLSSHVGENYETVRNWLVTQGFNINNISATYDY
SDTVPSGSIISQDPASGEVVAEETYINFVVSQGTEPKLNDISGYTKSEAQSYLASVGAEY
IGHETSEYSNTVDKDKVIRTVPGAGTTITKGMVVNVIYSKGPDPASSSSEKDSSDSSSSS
SSSSSTSNSSKEESSSSTSSSASTSESSK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagttgggcaaaaaattaaatggccgttatcaaatcactggaaatatcggtagc
ggtggtatggcaaatgtatttttggcgcacgatttaatcttggatcgtgatgtagcagtt
aaagtcttacgatttgactttcaaaatgaccagactgcgattcgacgatttcagagagaa
gctttagcagcaacagaactcgttcatccaaacattgttagtgtttacgatgttggtgaa
gaagacaacatgcagtatctggtgatggaatacgtcaaaggaatggacttgaaacgatat
atccaaacacattatcctgttccttatgaaacagcagtaaatattatgcagcagatcctt
tctgctatttctttagctcataaccatcaaatcatccaccgagatttgaaaccccaaaac
gtactgatcgataatgaaggtgttgtaaaaatcacggatttcgggattgctatcgcttta
tctgaaacatcgatcacgcagacgaatacgatgctaggatctgttcattatctgtcccct
gagcaggccagaggaagtatggcaacgaagcagtcagatatttatgctttagggatcatc
ctttatgagatgttgacgggtagcgtaccgtttgatggtgaatctgctgtaacaattgct
ttaaaacattttcaagatgatcttccatctataaaagcacttgatccaaatgtgccacaa
gcactggaaaacgtgattttacgggcaacggctaaagaacctgcagaccgttataagtca
gccgaggaaatgtctgatgatctttctacagtattatcaccagctcgtgcaaacgaagaa
aaatggcagcctcatgtgatggataatgaaacaaaagttatcacaccccttacggaagat
gcaccaatgcctgattcattcaaatctatgcctctgccaaaagacaagccagaaaacgaa
accttaccagaggaggaagaagttctgcctgatcctaaaaagaaaggacagaaaaaatgg
tggctgatcctattagctattcttgctgttttaggaatcggaacagctgtattctttgct
tctggcgggcgaggagaagttgttgttcctgatgtttctgatctttctgaagcttctgct
agagaaacactcgcaaaagcgaaattagaagtagcaacaaaaacagaagaaattgcagat
gacaaaatcgaagaaggtaatgtagtgaagacagacccggcagcgggaacgacagtcaag
caaaaacgcgaagtcactctgtatattagtagcggcacgaaaaaaatcaaattagatgat
tacagtggtaaaagttatgaagatgccgaagcaagtttgaaagaattagggttttctgct
gacttgattcaaaaagaagaggaattcagttcagaggtagaaagcggaatgatcatttcg
caatctccatcagaagatacagaagtcgatcctaaaacagacacgattactttcacagtc
agcaaaggaccagaaacagtgactttgagtagtcatgtaggagaaaactacgaaactgtt
cgtaattggcttgttacacaaggattcaatatcaataatattagtgctacttatgactat
agcgacactgtaccatcaggttcgatcatcagtcaggatccagcctcgggtgaagttgta
gcagaagaaacttacatcaattttgtcgtaagccaaggaacagagcctaaattgaatgat
atctccggctatacaaaaagcgaagcacaaagttatttagctagtgtcggtgcagaatat
atcgggcatgagacttccgaatattcaaacacggtggataaagataaagtgattcgtaca
gtaccaggggcaggaacgacaattaccaaaggaatggttgtgaacgtaatttactctaaa
ggaccagatccagcgtcttctagttctgaaaaagactcttcagacagttctagcagctca
agtagctccagtagcacaagcaactcttcaaaagaagaatcttccagctccacaagttca
tcagctagcacctcagaaagttcaaaataa

DBGET integrated database retrieval system